KEGG   Rattus norvegicus (rat): 54242Help
Entry
54242             CDS       T01003                                 

Gene name
Cpa3
Definition
(RefSeq) carboxypeptidase A3
  KO
K08780  carboxypeptidase A3 [EC:3.4.17.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04972  Pancreatic secretion
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    54242 (Cpa3)
  09154 Digestive system
   04972 Pancreatic secretion
    54242 (Cpa3)
   04974 Protein digestion and absorption
    54242 (Cpa3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    54242 (Cpa3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     54242 (Cpa3)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   54242 (Cpa3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 Propep_M14 GATase1_like DUF1642
Motif
Other DBs
NCBI-GeneID: 54242
NCBI-ProteinID: NP_062173
RGD: 2390
Ensembl: ENSRNOG00000011181
UniProt: P21961
Position
2q24
AA seq 417 aa AA seqDB search
MRSFLLMGVIYSTLAIAPVQFDREKVFRVKLQDEKQASILKNLTQTIELDFWYPDAIHDI
AVNMTVDFRVTEKESQTIQSTLEQHKMDYEILINDLQEEIDKQFDVKEEIAGRHSYAKYN
DWNKIVSWTEKMVEKHPEMVSRIKIGSTVEDNPLYVLKIGRKDGERKAIFMDCGIHAREW
VSPAFCQWFVYQAAKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTKDRMWRKNRSKN
PNSTCIGTDLNRNFDVSWDSSPNTDNPCLSVYRGPAPESEKETKAVTNFIRSHLNSIKAY
ITFHSYSQMLLFPYGYTIKLPPNHQDLLKVARIATDVLSSRYETRYIYGPIASTIYKTSG
SSLDWAYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILKHTS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccttcttgcttatgggggtcatctattccacacttgcaattgctcctgttcag
tttgacagggagaaggtattccgtgtgaaactccaggatgaaaagcaagcaagtatcttg
aagaacttgacccaaaccattgagcttgacttctggtatccagatgctatccatgatatt
gctgttaatatgactgtggatttccgagttactgagaaggaatctcagactatccagtct
accttggaacaacataaaatggactatgaaattctgataaatgacctacaagaagagata
gacaaacagtttgatgtgaaagaggaaatcgcaggcaggcacagttatgcaaaatacaat
gactggaacaagattgtttcttggactgaaaaaatggtagaaaaacatcctgaaatggtt
tcaaggattaaaattggatcaactgttgaagataatccattatatgttctcaagattggg
agaaaagatggagaaagaaaggctatctttatggactgtggcatccatgctcgtgaatgg
gtttccccagctttctgtcagtggtttgtctatcaggcagccaagagttatggaaaaaat
aaaatcatgaccaaacttttggaccggatgaatttttatgttctgcccgtattcaatgta
gatggatacatttggtcatggacaaaggatcgaatgtggagaaaaaaccgttccaagaac
ccaaattcaacctgcattggcactgacctcaacaggaacttcgatgtctcatgggactct
tccccaaacaccgacaacccatgcctcagtgtctacaggggacctgcaccagagtccgag
aaagagacaaaagctgtcactaacttcattcgaagtcatctgaactcaatcaaggcttat
atcaccttccattcctactctcagatgctgttatttccttatggctacacaatcaaactg
ccacccaaccaccaggacctgctgaaggttgcgaggattgccactgatgttctctcaagt
agatatgaaacccgttatatctacggcccaatagcatccacaatttacaagacatcaggt
tcttctttagactgggcttatgacctgggcatcaaacacacatttgcctttgagcttcgt
gataaaggaaaatctggtttccttcttccagaatctcggataaagccaacatgtaaagaa
accatgctttctgtcaaatttattgccaagtatatcctcaagcatacttcctaa

DBGET integrated database retrieval system