KEGG   Rattus norvegicus (rat): 54254
Entry
54254             CDS       T01003                                 

Gene name
Gata4
Definition
(RefSeq) transcription factor GATA-4
  KO
K09183  GATA-binding protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04218  Cellular senescence
rno04530  Tight junction
rno04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    54254 (Gata4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    54254 (Gata4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    54254 (Gata4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    54254 (Gata4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    54254 (Gata4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    54254 (Gata4)
SSDB
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap Apidaecin Prim_Zn_Ribbon
Other DBs
NCBI-GeneID: 54254
NCBI-ProteinID: NP_653331
RGD: 2665
Ensembl: ENSRNOG00000010708
UniProt: P46152
Position
15
AA seq 440 aa
MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSG
AASGATSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYSSSGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNAC
GLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKL
HGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPPGESLPPSSGASSNSSNATSSSSSSEE
MRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGSSIHPVLSALKLSPQGYPSPVTQTSQASS
KQDSWNSLVLADSHGDIITA
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgtaccaaagcctggctatggccgccaaccacgggcccccgccgggcgcctacgaagcg
ggtggacctggcgccttcatgcacagtgcgggcgccgcgtcctcgcccgtctacgtgccc
actccgcgggtgccgtcctctgtgctgggcctgtcctacctgcagggcggaggcagtggt
gctgcttctggagccacctcgggtggcagctccggggccggcccgtcgggtgctgggcct
gggacccagcagggtagcccgggctggagccaggctggagctgagggagccgcttacacc
ccaccgcctgtgtccccgcgcttctccttcccggggactactgggtccctggcggccgcc
gccgccgctgccgcagcccgggaagctgcagcctacagcagtagcggcggggcagccggc
gctggcctggctggccgagagcagtacgggcgtccgggcttcgcaggctcctactccagc
ccctacccagcctacatggccgatgtgggcgcatcctgggccgcagccgctgccgcctcc
gccggccccttcgacagcccagtcctgcacagcctacctggccgggccaaccctgcgaga
caccccaatctcgatatgtttgatgacttctcagaaggcagagagtgtgtcaactgcggg
gccatgtccaccccactctggaggcgagatgggacaggacactacctatgcaacgcctgt
ggcctctaccacaagatgaatggtatcaaccggcccctcatcaagcctcagcgccggctg
tctgcctcccgccgggtaggcctctcctgtgccaactgccagactaccaccaccacactg
tggcgccgtaacgctgagggcgagcctgtttgcaatgcctgcggcctctacatgaagctc
catggggttcccaggcctcttgcaatgcggaaggaggggattcaaaccagaaaacggaag
cccaagaatctgaataaatctaagacaccagcaggtcctcctggcgagagcctccctccc
tccagtggtgcctccagcaactccagcaacgccaccagcagcagcagcagcagtgaagag
atgcgccccatcaagacagagcccgggctgtcatctcactatgggcacagcagctccatg
tcccagacattcagtactgtgtccggccatgggtcctccatccatccagtgctgtcggct
ctgaagctctccccacaaggctatccatctcctgtcactcagacatcacaggccagctcc
aagcaggactcttggaacagcctggtcctggctgacagtcatggggacataatcaccgcg
taa

DBGET integrated database retrieval system