KEGG   Rattus norvegicus (rat): 54257Help
Entry
54257             CDS       T01003                                 

Gene name
Grik2, GluK2, GluR6
Definition
(RefSeq) glutamate ionotropic receptor kainate type subunit 2
  KO
K05202  glutamate receptor, ionotropic kainate 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    54257 (Grik2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    54257 (Grik2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54257 (Grik2)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   54257 (Grik2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 54257
NCBI-ProteinID: NP_062182
RGD: 2733
Ensembl: ENSRNOG00000000368
Vega: OTTRNOG00000001092
UniProt: P42260
Structure
PDB: 

Position
20q13
AA seq 908 aa AA seqDB search
MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgaagattatttccccagttttaagtaatctagtcttcagtcgctccattaaagtcctg
ctctgcttattgtggatcggatattcgcaaggaaccacacatgtgttaagattcggtggt
atatttgaatatgtggaatctggccccatgggagcagaagaacttgcattcagatttgct
gtgaataccatcaacagaaacaggactttgctgcccaacaccactttaacttatgatact
cagaagatcaatctctatgacagttttgaagcatctaagaaagcttgtgatcagctgtct
cttggggtggctgctatcttcggtccttcacacagttcatcagccaatgctgtgcagtcc
atctgcaatgctctgggggttccccacatacagacccgctggaagcaccaggtgtcagac
aacaaggattccttctacgtcagtctctacccagacttctcttccctgagccgcgccatc
ttggatttggtgcagttttttaagtggaaaactgtcacagttgtgtatgacgacagcact
ggtctcattcgcttgcaagagctcatcaaagctccatcgaggtacaatcttcgacttaaa
attcgtcagctgccagctgataccaaagatgcaaaacctttgctgaaggagatgaaaaga
ggcaaggagttccacgtgatcttcgactgcagccatgagatggcagcaggcattttaaaa
caggcattagctatgggaatgatgacagaatactatcactatatatttacaactctggac
ctctttgctcttgacgtggagccctacagatacagtggcgtaaatatgacagggttcagg
atactaaatacagagaatacccaagtctcctccatcatcgaaaagtggtctatggaacgg
ttacaggcgcctccaaaacctgactcaggtttgctggatggatttatgacgactgatgct
gctctgatgtatgatgcagtgcacgttgtgtctgtggctgtccaacagtttccccagatg
acagtcagctccttgcaatgcaatcgacacaaaccctggcgctttgggacccgcttcatg
agtctaattaaagaggctcactgggaaggtctcacaggcagaataacatttaacaaaacc
aatggattacggacagattttgatttggatgtgatcagtctcaaggaagaaggtctggag
aagattggaacttgggatccagccagtggcctgaatatgacagaaagtcagaaaggaaag
ccagcaaatatcacagactcattgtctaatcgttctttgattgttaccaccattttggaa
gaaccgtatgttctgtttaagaagtctgacaaaccactctatgggaatgatcgatttgaa
ggctactgtattgatctcctacgagagttatctacaatccttggctttacatatgagatt
aggcttgtggaggatgggaaatatggagcccaggatgatgtgaacggacaatggaatgga
atggttcgtgaactaatcgatcataaagctgaccttgcagttgctccactggctataacc
tatgttcgtgagaaggtcatcgacttttcaaagccgtttatgacacttggaataagtatt
ttgtaccgcaagcccaatggtacaaacccaggcgtcttctccttcctgaatcctctctcc
cctgatatctggatgtatgttctgctggcttgcttgggtgtcagttgtgtgctctttgtc
atagccaggtttagtccctatgagtggtataacccacacccttgcaaccctgactcagac
gtggtggaaaacaattttaccttgctaaatagtttctggtttggagttggagctctcatg
cggcaaggttctgagctcatgcccaaagcactctccaccaggatagtgggaggcatttgg
tggtttttcacacttatcatcatttcttcgtataccgctaacctagccgcctttctgact
gtggaacgcatggagtcgcccattgactctgctgacgatttagctaagcaaaccaagata
gagtatggagcagtggaggacggcgcaaccatgacgttttttaagaaatcaaaaatttca
acgtatgataaaatgtgggcgtttatgagcagcaggagacagtctgtgcttgtcaaaagc
aatgaggaagggatccaacgagtcctcacctcggattatgctttcttaatggagtcaaca
accatcgagtttgttacacagcggaactgtaacctcacgcagattggcggccttatagac
tccaaaggctatggcgttggcactcctatgggctctccatatcgagacaaaatcaccata
gcaattcttcagctgcaggaggaaggcaagctgcacatgatgaaggagaaatggtggcgg
ggcaatggctgcccagaggaggagagcaaagaggccagtgctctgggggtgcagaatatt
ggtggtatcttcattgtcctggcagccggcttggtgctctcagtttttgtggcagtggga
gagtttttatacaaatccaaaaaaaacgctcaattggaaaagaggtccttctgtagcgct
atggtggaagagctgagaatgtccctgaagtgccagcgtcggctcaaacataagccacag
gccccagttattgtgaaaacagaagaagttatcaacatgcacacatttaacgacagaagg
ttgccaggtaaagaaaccatggcatga

DBGET integrated database retrieval system