KEGG   Rattus norvegicus (rat): 54259Help
Entry
54259             CDS       T01003                                 

Gene name
Inpp5d
Definition
(RefSeq) inositol polyphosphate-5-phosphatase D
  KO
K03084  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1 [EC:3.1.3.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    54259 (Inpp5d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    54259 (Inpp5d)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    54259 (Inpp5d)
   04664 Fc epsilon RI signaling pathway
    54259 (Inpp5d)
   04666 Fc gamma R-mediated phagocytosis
    54259 (Inpp5d)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    54259 (Inpp5d)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.86  phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase
     54259 (Inpp5d)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    54259 (Inpp5d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH2 Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 54259
NCBI-ProteinID: NP_062184
RGD: 2914
Ensembl: ENSRNOG00000017020
UniProt: P97573
Position
9q35
AA seq 1190 aa AA seqDB search
MPAMVPGWNHGNITRSKAEELLSRAGKDGSFLVRASESIPRAYALCVLFRNCVYTYRILP
NEDDKFTVQASEGVPMRFFTKLDQLIEFYKKENMGLVTHLQFPVPLEEEDAIDEPEEDTE
SVMSPPELPPRNIPVSGGPCEAKDLPLPTENPRAPEVTRLSLSETLFQRLQSMDTSGLPE
EHLKAIQDYLSTQLMLDSDFLKTGSSNLPHLKKLTSLLCKELHGEVIRTLPSLESLQRLF
DQQLSPGLRPRPQVPGEANPITMVAKLSQLTSLLSSIEDKVKALLHEGSESTNRRSLIPP
VTFEVKSESLGIPQKMHLKVDVESGKLIIKKSRDGSEDKFYSHKKILQLIKSQKFLNKLV
ILVETEKEKILRKEYVFSDSKKREGFCQLLQQMKNKHSEQSEPDMITIFIGTWNMGNAPP
PKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLGEKEWLEILRHSLQEVTSMTFK
TVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFV
NSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWLGDLNYRVELPTWE
AEAIIQKIKQQQYSDLLAHDQLLLERKEQEVFLHFEEEEITFAPTYRFERLTRDKYAYTK
QKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVS
KNGPGAVDSQGQIEFLACYATLKTKSQTKFYLELHSSCLESFVKSQEGENEEGDEGELVV
RFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLETTESQLPIYTPLT
HHGEMTGHFRGEIKLQTSEGKMREKLYDFVKTERDESSGMKCLKNLTSHDPMRQWEPAGR
VPACGISSLNEIINPNYIGMGPFGQPLHGKSTLSPDQQLTAWSYDQLPKDSSLGPGRGEG
PPTPPSQPPLSPKKFSSSTANRGSCPRVQETRPGDLGKVEALPQEDLPLTKPEMFENPLY
GSVSPFPKLVPRKEQESPKMMRKEPPPCPDPGVSSPSIMLPKAQEVENVKGTSKQAPVPV
FGPTPRIRSFTCSSSAEGRMPSGDKSQGKPKAPASSQAPVPVKRPVKPSRSEMSQQTTPI
PAPRPPLPVKSPAVLQLQHSKGRDYRDNTELPHHGKHRQEESLLGRTAMQ
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccatggtccctgggtggaaccatggtaacatcacccgatccaaggcagaggag
ctactttccagagctggcaaggacgggagcttccttgtgcgtgccagcgagtccatcccc
cgggcctacgcgctctgcgtgctgttccggaattgcgtttacacttacaggattctgccc
aatgaggacgataaattcactgttcaggcatccgaaggtgtgcccatgaggttcttcacg
aagttggaccagctcatcgagttttacaagaaagaaaacatggggctggtgacccacctg
cagttccctgtgcctctggaggaggaggatgctattgatgagcctgaagaggacacagaa
agtgtcatgtcaccacctgagctgcctcccagaaacatccctgtgtctggtgggccctgc
gaggccaaggaccttcctcttccaacagagaacccccgagctcctgaggtcacccggctg
agtctctccgagacactgtttcagcgtctacagagtatggataccagtgggctcccggag
gagcacctgaaagccatccaggattatctgagcactcagctcatgctggactctgacttt
ctgaagacaggctccagcaacctccctcacctgaagaagctgacttcactcctctgcaag
gaactccatggagaagtcatcaggaccctcccgtccctggagtctctgcagaggttgttt
gaccagcagctctccccaggccttcgcccacgacctcaggtgcccggagaggccaatccc
atcaccatggtggccaaactgagtcaattgacaagtctgctgtcttccattgaagataag
gtcaaggccttgctgcatgagggctctgagtctaccaacaggcgttcccttatccctccg
gtcacctttgaggtgaagtcagagtccctgggcattcctcagaaaatgcatctcaaagta
gacgtcgagtctgggaaactgatcattaagaagtccagagatggttctgaggacaagttc
tacagccacaaaaaaattctgcagctcattaagtcccagaagtttctgaacaagctggtg
attttggtggagacggagaaggagaaaatcctgaggaaggagtatgtgttttctgactct
aaaaagagagaaggcttctgccagctcctgcagcagatgaagaacaagcactcggagcag
tcagagcctgacatgatcaccatcttcattggcacttggaacatgggtaatgcaccccct
cccaagaagatcacgtcctggtttctctccaaggggcagggaaagacacgggacgactct
gctgactatatcccccatgacatctacgtgattggcacccaggaggaccccctgggagag
aaggagtggctggagatactcaggcactccctgcaagaagtcaccagcatgacatttaaa
acagttgccatccacaccctctggaacattcgcatagtggtgctcgccaagccggagcat
gagaaccggatcagccacatctgcactgacaatgtgaagacaggcatcgcgaacaccctg
ggaaacaaaggagctgtgggagtgtccttcatgttcaatggaacctccttggggttcgtc
aacagtcacttgacttctggaagtgaaaaaaaactcaggcgaaatcaaaactatatgaac
atcctgcggttcctggccctgggagacaagaagctaagcccatttaacatcacccaccgc
ttcacccacctcttctggcttggggatctcaactaccgtgtggagctgcccacctgggag
gcagaggccatcatccagaagattaagcagcagcagtactcagatcttctggcccacgac
caactgctcctggagaggaaggagcaggaagtcttcctgcactttgaggaggaggagatc
accttcgcccccacctatcgatttgaaagactgacccgggacaagtacgcttacacgaag
cagaaagccacagggatgaagtacaatttgccatcctggtgcgaccgagtcctctggaag
tcttacccgctggtgcatgtggtctgtcagtcctacggcagtaccagtgacatcatgacg
agtgaccacagccctgtctttgccacgtttgaagcaggagtcacatcgcagttcgtctcc
aagaatggtcctggcgccgtggacagccaagggcagattgagtttcttgcatgctacgcc
acactgaagaccaagtcccagactaagttctacttggagctccactcaagctgcttagag
agttttgtcaaaagtcaggaaggagaaaacgaagagggagatgaaggagaactggtggta
cggtttggagagactcttcccaagctaaagcccattatctctgaccctgagtacttactg
gaccagcacattctgatcagcattaaatcttctgacagtgacgagtcctatggtgaaggc
tgcattgcccttcgtctggagaccacagagagtcagcttcccatctacacacctctcacc
caccacggggagatgactggccacttcaggggagagattaagctgcagacctctgagggc
aagatgagagagaagctctatgactttgtgaagacagagcgggatgagtccagtggaatg
aagtgcttgaagaacctcaccagccatgaccccatgaggcagtgggagcctgctggcagg
gtccctgcatgtggtatctccagcctcaatgagatcatcaatccaaactatattggtatg
gggccttttggacagcccctgcatgggaaatcaaccctgtccccagaccagcaactcaca
gcctggagttatgaccagctccccaaggactcctccctggggcccgggaggggagagggt
cctcccacccctccctcccagccacctctgtcaccaaagaagttttcatcctctacagcc
aaccgaggttcctgccccagggtgcaagaaacaagacctggcgatctgggaaaggtggaa
gccctgccgcaggaggacctgccgctgacgaagcccgagatgtttgagaacccactgtat
gggtccgtgagtcccttccctaagctggtgcccaggaaagagcaggagtctcccaagatg
atgcgcaaggagcccccgccctgcccagacccaggagtctcttcacccagcatcatgctc
cccaaagcccaagaggtggagaatgtcaaggggacgagcaaacaggcccctgtgcctgtc
tttggccccacaccccggatccgttcctttacctgttcctcctctgctgagggcaggatg
cccagtggggacaagagccaagggaagcccaaggccccagccagttcccaagccccagtg
ccagtcaagaggcccgtcaagccttccaggtcagaaatgagccagcagacaacgcccatc
ccagctccacggccacccctgccagtcaagagtcctgcagtcttgcagctgcagcattcc
aaaggcagagactaccgtgacaacacagaactcccccaccatggcaagcaccgccaggag
gagagtctgcttggcagaactgccatgcagtga

DBGET integrated database retrieval system