KEGG   Rattus norvegicus (rat): 54261
Entry
54261             CDS       T01003                                 

Gene name
Kcnn1
Definition
(RefSeq) small conductance calcium-activated potassium channel protein 1
  KO
K04942  potassium intermediate/small conductance calcium-activated channel subfamily N member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54261 (Kcnn1)
   04929 GnRH secretion
    54261 (Kcnn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54261 (Kcnn1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   54261 (Kcnn1)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 DALR_1 Ion_trans Seryl_tRNA_N DUF4140
Other DBs
NCBI-GeneID: 54261
NCBI-ProteinID: NP_062186
RGD: 2962
Ensembl: ENSRNOG00000029264
UniProt: P70606
Position
16
AA seq 536 aa
MSSRSHNGSVGRPLGSGPGFLGWEPVDPEAGRPRQPTQGPGLQMMAKGQPAGLSPSGPRG
HSQAQEEEEEEEDEDRPGSGKPPTVSHRLGHRRALFEKRKRLSDYALIFGMFGIVVMVTE
TELSWGVYTKESLCSFALKCLISLSTVILLGLVILYHAREIQLFLVDNGADDWRIAMTWE
RVSLISLELAVCAIHPVPGHYRFTWTARLAFSLVPSAAEADVDVLLSIPMFLRLYLLARV
MLLHSRIFTDASSRSIGALNRVTFNTRFVTKTLMTICPGTVLLVFSISSWIVAAWTVRVC
ERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVAV
VARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQSRVRKHQ
RKFLQAIHQAQKLRTVKIEQGKVNDQANTLADLAKAQSIAYEVVSELQAQQEELEARLAA
LESRLDVLGASLQALPSLIAQAICPLPPPWPGPSHLTTAAQSPQSHWLPTTASDCG
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgagtagccgcagccacaatggcagtgtggggcggcctctgggcagtgggcctggattc
ctgggctgggaacctgtggaccccgaggcaggccgcccccgacagcccacccaaggcccc
ggcctgcagatgatggccaagggtcagcctgctgggctgtcacccagtggccccaggggc
cactcccaggcgcaggaggaggaagaggaagaggaagacgaggacaggccaggctcaggg
aagcccccgaccgtcagtcaccgcctgggccaccgtagggccctcttcgagaagcgtaaa
cgactcagtgactatgcactcatctttggcatgttcgggattgtcgtcatggtgacagaa
acagagctgtcctggggtgtgtacaccaaggagtctctgtgctcattcgccctgaaatgc
ctaatcagcctctccactgtcatcctgcttggccttgtcatcctctaccacgcccgagag
atccagctgttcctggtggacaatggtgccgatgactggcgcattgccatgacgtgggag
cgagtgtccctgatctcgctggagttggctgtgtgtgccatccacccagtgcctggccac
taccgcttcacatggacggcgcggctggccttctccctggtgccgtcagcagccgaggcg
gatgtggatgtgcttctgtccatccccatgtttctgcgcctctatctgctggctcgggtc
atgctcctgcacagccgcatcttcacggacgcatccagtcgcagcatcggagccctgaac
cgtgtcaccttcaacacacgctttgtcaccaagacactcatgaccatctgccctggcacc
gtgctgttggtcttcagcatctcctcctggatcgtcgctgcatggacagtgcgcgtgtgt
gagaggtaccatgataaacaggaagtgaccagcaacttcctgggggccatgtggctcatc
tccattaccttcctgtccatcggctacggggacatggtgccgcacacctactgtgggaag
ggcgtgtgtctgctcaccggcatcatgggagcaggctgcactgcactcgtggtggccgtc
gtggcccggaagttggaactcaccaaggctgagaaacacgtgcacaacttcatgatggac
acacagctcaccaagcgggttaaaaacgccgctgcaaacgttctcagggagacatggctc
atctacaaacacaccaggctagtgaagaagccagaccaaagccgggttcggaaacaccag
cgtaagttccttcaggccatccatcaggcgcagaagctccggactgtgaagattgaacaa
gggaaggtgaatgatcaggccaacacgctggctgacctggccaaggcacagagcatcgca
tatgaggtggtgtcggagctgcaggcccagcaggaggagttggaggcccgtctggctgcc
ctggagagccgcctggatgtcctaggcgcctccctgcaggccctaccaagtctcatagcc
caagccatatgccctctaccaccaccctggcccgggcccagtcacctgaccacagccgcc
cagagcccacaaagccactggctgcccaccacggcatcagactgtgggtga

KEGG   Rattus norvegicus (rat): 54262
Entry
54262             CDS       T01003                                 

Gene name
Kcnn2
Definition
(RefSeq) small conductance calcium-activated potassium channel protein 2 isoform 2
  KO
K04943  potassium intermediate/small conductance calcium-activated channel subfamily N member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04726  Serotonergic synapse
rno04911  Insulin secretion
rno04929  GnRH secretion
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54262 (Kcnn2)
   04929 GnRH secretion
    54262 (Kcnn2)
  09154 Digestive system
   04976 Bile secretion
    54262 (Kcnn2)
  09156 Nervous system
   04726 Serotonergic synapse
    54262 (Kcnn2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54262 (Kcnn2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   54262 (Kcnn2)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 Med9 YvrJ IRK UNC80
Other DBs
NCBI-GeneID: 54262
NCBI-ProteinID: NP_062187
RGD: 2963
Ensembl: ENSRNOG00000016675
UniProt: P70604
Structure
PDB: 

Position
18
AA seq 580 aa
MSSCRYNGGVMRPLSNLSSSRRNLHEMDSEAQPLQPPASVVGGGGGASSPSAAAAASSSA
PEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGGGGGSGHGSSSGTKSSKKKNQNIGY
KLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTI
ILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTA
RLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTR
FVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSI
GYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRV
KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTL
VDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDF
IETQMENYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgagcagctgcaggtacaacgggggcgtcatgcgtccgctcagcaacttgagctcgtcc
cgccggaacctgcacgagatggactcagaggctcagcccctgcagcccccagcgtcggtt
gtaggaggaggtggtggtgcgtcctccccgtctgctgccgccgccgcctcatcctcagcc
ccagagatcgtggtgtctaagccggagcacaacaattctaacaacctggcgctctacgga
actggcggcggaggcagcaccggaggcggcggcggcggcggcggcggcggcggcggcagc
gggcatggcagcagcagcggcactaagtccagcaaaaagaagaaccagaacatcggctat
aagctgggccatcggcgtgccctgtttgagaagcgcaagcggctcagcgactatgcgctc
atcttcggcatgttcggcatcgtggtcatggtcatcgagaccgagctgtcgtggggcgcc
tacgacaaggcgtcgctgtattctttagctctgaaatgccttatcagtctctccacgatc
atcctgcttggtctgatcatcgtataccacgccagggaaatacagttattcatggtggac
aatggagcagatgactggagaatagccatgacttatgagcgtattttcttcatctgcttg
gaaatactggtgtgtgctattcatcccatccctgggaattatacgttcacatggacagcc
cggcttgccttctcctatgccccttccacaaccactgcagacgtggatattattttatct
ataccaatgttcttaagactctatctgattgccagagtcatgctattacatagcaaactt
ttcaccgatgcctcctctagaagcattggggcacttaataagataaacttcaatacgcgt
tttgttatgaagactttaatgactatctgcccaggaactgtgctcttggtttttagtatc
tcgttatggataattgccgcatggactgtccgagcttgtgaaaggtaccatgatcaacag
gatgtcactagcaacttccttggagcaatgtggttgatatcaataacttttctctccatt
ggttatggtgacatggtacctaacacatactgtgggaaaggagtctgcttgcttaccgga
ataatgggtgcaggttgcacagccttggtggtagccgtagtggcaagaaagctagaactt
accaaagcagaaaagcatgtgcacaatttcatgatggatactcagctgaccaaaagagta
aaaaacgcagccgccaatgtactcagggaaacgtggttaatctacaaaaacacaaagcta
gtgaaaaagatcgaccatgcaaaagtaaggaagcatcaacggaaattcttacaagctatt
catcaattaagaagtgtgaagatggaacagaggaaactgaatgaccaagcgaatactcta
gtggatctggcaaagacccagaatatcatgtatgatatgatttccgacttaaatgaaagg
agtgaagactttgagaaaaggatcgtcaccctggaaacaaaattagaaactttgattggt
agcattcatgccctccctgggcttatcagccagaccatcagacagcagcaaagggacttc
atagagacacagatggagaactatgacaagcatgtcacctacaatgctgagcgttcccgg
tcctcgtccaggaggcggcggtcctcctccacagcgccaccaacttcatctgagagtagc
tag

KEGG   Rattus norvegicus (rat): 54263
Entry
54263             CDS       T01003                                 

Gene name
Kcnn3
Definition
(RefSeq) small conductance calcium-activated potassium channel protein 3
  KO
K04944  potassium intermediate/small conductance calcium-activated channel subfamily N member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54263 (Kcnn3)
   04929 GnRH secretion
    54263 (Kcnn3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54263 (Kcnn3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   54263 (Kcnn3)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2 IRK
Other DBs
NCBI-GeneID: 54263
NCBI-ProteinID: NP_062188
RGD: 2964
Ensembl: ENSRNOG00000020706
UniProt: P70605
Position
2
AA seq 731 aa
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPSAPPAVPQQPPGPLLQPQPPQ
LQQQQQQQQQQQQQQQQQQAPLHPLPQLAQLQSQLVHPGLLHSSPTAFRAPNSANSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNAT
HNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKH
QRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSLE
SKLEHLTASFNSLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISSTS
FPTPYTSSSSC
NT seq 2196 nt   +upstreamnt  +downstreamnt
atggacacttctgggcacttccatgactcgggggtgggggatctggatgaagaccccaag
tgtccctgtccatcttctggggacgagcaacagcagcaacagcaaccgccaccaccgtca
gcgccaccagcagtcccccagcagcctccgggacccttgctgcagcctcagcctccgcag
cttcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaggct
ccactgcaccccctgcctcagcttgcccaactccagagccagcttgtccatcctggtctg
ttgcactcttctcccacggctttcagggctcccaattcagccaactccaccgccatcctc
cacccttcctccaggcaaggcagccagctaaatctcaatgaccacttgcttggccactct
ccaagttccacagccacaagtgggcctggtggaggcagccggcaccggcaggccagcccc
ctggtgcaccggcgggacagcaatcccttcacggagatagctatgagctcctgcaaatac
agcggtggggtcatgaagcccctcagccgcctcagcgcctctcggagaaaccttatcgag
gccgagcctgagggccaacccctccagctcttcagtcccagcaaccccccagagattatc
atctcctccagggaggataaccatgcccaccagactctgctccatcaccccaacgctacc
cacaaccaccagcatgccggcaccactgctggcagcaccaccttccccaaagccaacaag
cggaaaaaccaaaacattggctataagctggggcacaggagggccctgtttgaaaagaga
aagcgactgagtgactatgctctgatttttgggatgtttggaattgttgttatggtgata
gagaccgaactgtcttggggtttgtactcaaaggattccatgttttcgttggccctgaaa
tgccttatcagtttatccaccatcatcctgcttggtttgatcatcgcctaccacacaagg
gaagtacagctctttgtgatcgacaatggtgcagatgactggcggatagccatgacctat
gagcgcatcctctacatcagcctggagatgctggtgtgcgccatccaccccattcctgga
gagtacaagttcttctggacggcacgcctggccttctcctacaccccctctcgggcagag
gctgacgtggacattattctgtccatccccatgttcttgcgcctatacctgatcgcccga
gtcatgctgctacatagcaagctcttcacggatgcctcatcccgaagcatcggggccctc
aacaagatcaacttcaacacccgattcgtcatgaagacgctcatgaccatctgcccgggc
acggtgctgctggtgttcagcatctctctgtggatcatcgctgcctggactgtgagagtc
tgtgaaaggtaccatgaccagcaggacgtaactagtaactttctgggtgccatgtggctc
atctccatcacgttcctttccattggctatggggacatggtgccccacacatactgtggg
aaaggtgtctgtcttctcactggcatcatgggtgcaggctgcactgccctcgtggtagct
gtggttgcccgaaagctcgaactcaccaaagcagagaagcatgtgcacaacttcatgatg
gacactcagctcaccaaacggatcaagaacgctgccgccaatgtcctccgggaaacatgg
ctgatctacaaacacacaaagctgctaaagaagattgaccacgccaaagtcaggaaacac
cagaggaagttcctccaagctattcaccaactgaggggtgtcaagatggaacaaaggaag
ctgagtgaccaagccaacaccctggtggacctttccaagatgcagaacgtcatgtatgac
ttgatcacggagctcaacgaccggagtgaagacctggaaaagcagattggcagcctggaa
tccaagctggagcacctcacagccagcttcaattccctgcccctgctcatcgcagacacc
ctgcgccaacagcagcagcagctgctcactgccttcgtggaggcccggggcatcagtgtg
gctgtgggaactagccacgcccctccctctgacagccctatcgggatcagctccacctct
ttcccaaccccatacacaagttcaagcagttgctaa

KEGG   Rattus norvegicus (rat): 65206
Entry
65206             CDS       T01003                                 

Gene name
Kcnn4
Definition
(RefSeq) intermediate conductance calcium-activated potassium channel protein 4 isoform a
  KO
K04945  potassium intermediate/small conductance calcium-activated channel subfamily N member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
rno04929  GnRH secretion
rno04970  Salivary secretion
rno04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    65206 (Kcnn4)
   04929 GnRH secretion
    65206 (Kcnn4)
  09154 Digestive system
   04970 Salivary secretion
    65206 (Kcnn4)
   04974 Protein digestion and absorption
    65206 (Kcnn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    65206 (Kcnn4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   65206 (Kcnn4)
SSDB
Motif
Pfam: SK_channel CaMBD Ion_trans_2
Other DBs
NCBI-GeneID: 65206
NCBI-ProteinID: NP_001257630
RGD: 621476
Ensembl: ENSRNOG00000019440
UniProt: A1A5N3
Position
1
AA seq 424 aa
MGGELVTGLGALRRRKRLLEQEKRVAGWALVLAGTGIGLMVLHAEMLWFLGCKWVLYLLL
VKCLITLSTAFLLCLIVVFHAKEVQLFMTDNGLRDWRVALTRRQVAQILLELLVCGVHPV
PLRSPHCTLAGEATDSQAWPGFLGEGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSI
GALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLTDTLW
LIPITFLTIGYGDVVPGTLWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHNFM
MDIHYAKEMKESAARLLQEAWMYYKHTRRKDSRAARRHQRKMLAAIHTFRQVRLKHRKLR
EQVNSMVDISKMHMILCDLQLGLSASHLALEKRIDGLAGKLDALTELLSTALQQQPPEPI
QEAT
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggcggggagctggtgactggcctgggggccctgagacggagaaagcgcctgctggag
caggagaagagggtggccggctgggcactggtactggcgggaactggcatcggactcatg
gtgctgcacgctgagatgttgtggttcctgggttgcaagtgggtgctgtacctgctcttg
gttaagtgtttaatcacgctgtccactgccttcctcctttgtcttattgtggtcttccat
gccaaggaggtccagctgttcatgactgacaacgggctccgggactggcgcgtggcgctg
acccggcggcaggtggcgcagatcctgctggagctgctggtatgcggggtgcacccggtg
cccctacggagcccgcactgcaccctggcgggggaggccacagactcacaggcctggccg
ggcttcctgggcgaaggcgaggcgttgctgtccctggccatgctgctacgtctctacctg
gtgcctcgcgcggtacttctgcgtagcggggtcctgctcaacgcgtcttaccgcagcatc
ggggcgctcaaccaagtccgattccgccactggttcgtggccaaactatacatgaacacg
cacccgggtcgcctgcttctgggcctcacgctgggcctctggctcaccacagcttgggtg
ctgtctgtggctgagaggcaggctgtcaatgccacgggacacctcacagacacactgtgg
ctgatacccatcacgttcctgaccattggctatggggacgtcgtacctggcaccctatgg
ggcaagattgtctgcttgtgcaccggagtcatgggggtctgctgcacggctctactagtg
gctgtggtggcccggaagctggagttcaacaaggcggagaaacacgtgcacaacttcatg
atggacatccattatgccaaagagatgaaggagtcggccgctcggctgctgcaggaagcc
tggatgtactacaaacacactcgaaggaaggactcccgagcggctcgcaggcatcagcgc
aagatgctggctgccatccacacgttccgccaggtacggctgaaacatcggaagctccgg
gaacaagtgaattccatggtggacatctccaagatgcacatgatcctgtgcgacctgcag
ctcgggctcagcgcctcgcaccttgccctggagaagagaatcgatgggctggcagggaag
ctggatgccctgactgaactgctcagtactgccctgcagcagcagccgccagaacccatc
caggaggccacatag

DBGET integrated database retrieval system