KEGG   Rattus norvegicus (rat): 54272
Entry
54272             CDS       T01003                                 

Gene name
Mcpt9
Definition
(RefSeq) mast cell protease 9
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 Prefoldin_3
Other DBs
NCBI-GeneID: 54272
NCBI-ProteinID: NP_062196
RGD: 3068
UniProt: P97611
Position
15p12
AA seq 246 aa
MITNSGWPVLPVNTEGGEIIWGTESKPHSRPYMAFINFYDSNSDLNRCGGFLVAKDIVMT
AAHCNGRNIKVILGAHNIKKRENTQVISVLKAKPHENFNSDSLVNDIMLLKLERKAQLNG
VVKTIALPRSQDWVKPGQVCTVAGWGTLANCTLSNTLQEVNLEVQKGQKCQGMSRNYNDS
IQLCVGNPNERKATAGGDSGGPFVCNGVAQGIVSYRLCTWTPPRVFTRISSFIPWIQKTM
KLLQQP
NT seq 741 nt   +upstreamnt  +downstreamnt
atgattacgaattccggttggcctgtcctaccagtcaacactgaaggaggagagatcata
tggggtacagagtccaaaccccactcccggccttacatggcattcataaatttttatgat
agcaattcagacctcaatcgctgtggcggtttcctggtggcaaaagacattgtaatgaca
gcagctcactgtaatggaagaaatataaaagtaatcttaggtgctcacaatatcaagaaa
cgagaaaacacccaggtcatctctgttctaaaggccaaacctcacgagaactttaatagt
gattcactggttaatgacatcatgctcctgaagttggaacgcaaagctcaactcaatggt
gttgtgaagactattgcccttcctaggagccaggactgggtgaaacctgggcaggtgtgc
acagtggcaggttgggggaccttggccaattgtactttgtctaacacacttcaagaagtg
aatctagaagttcaaaaaggtcagaagtgccaaggcatgtccagaaactacaatgactcc
atccagctttgtgtgggaaaccccaatgagaggaaggctactgctgggggagactcaggg
ggtccatttgtgtgcaatggagtggcccagggcattgtcagttatcgcttgtgtacttgg
acacctcctcgagtattcaccagaatctccagcttcataccgtggattcagaaaacaatg
aaactccttcaacaaccctag

DBGET integrated database retrieval system