KEGG   Rattus norvegicus (rat): 54276Help
Entry
54276             CDS       T01003                                 

Gene name
Neurod2
Definition
(RefSeq) neuronal differentiation 2
  KO
K09078  neurogenic differentiation factor 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    54276 (Neurod2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    54276 (Neurod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuro_bHLH HLH CCDC106 Nop53 CDC45
Motif
Other DBs
NCBI-GeneID: 54276
NCBI-ProteinID: NP_062199
RGD: 3166
UniProt: Q63689
Position
10q31
AA seq 381 aa AA seqDB search
MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPQPPPAPGSGAPGPARATKPVSL
RGEEVPEPTLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAAAFTARVARSAMHPYP
YPCSRLAGDSARRPAAGRRRGARLRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSP
PLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPAGHGLVFGSSAVRGGVHSENLLSY
DMHLHHDRGPMYEELNAFFHN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgctgacccgcctgttcagcgagcccggcctcctctcggacgtgcccaagttcgccagc
tggggcgacggcgacgacgacgagccgaggagcgacaagggcgacgcgccgccgcagcct
cctcctgctccagggtcaggggctccaggacccgctcgggccaccaagccagtgtctctt
cgtggagaagaggtccctgaacccacgttggctgaggtcaaggaggaaggagagctgggc
ggcgaggaggaggaggaagaggaggaggaggaaggactagacgaggcggaaggcgagcgg
cccaagaagcgcgggccgaagaaacgcaagatgaccaaggcgcgcctggagcgctccaag
ctgcggcgacagaaggccaacgcgcgggagcgcaaccgcatgcacgacctgaacgcggcg
ctggacaacctgcgcaaggtggtgccctgctactccaagacgcagaagctgtccaagatc
gaaacgctgcgcctggccaagaactacatctgggctctctcggagatcttgcgctccggg
aagcggccggatctggtgtcctacgtgcagactctgtgcaaggggctgtcacagcccacc
acgaatctggtggccggctgcctgcagctgaactctcgtaacttcctcacggagcagggc
gcggacggcgcggccgctttcacggctcgggtggcccgttccgccatgcatccgtacccg
tacccgtgctcgcgcctagcaggcgacagtgccaggcggccggcggctgggcggaggcgc
ggcgcacgcctgcggacccacggctactgcgccgcctacgagacgctgtacgcggcggcg
ggtggcggcggcgccagcccggactacaacagctccgagtacgagggtccgctcagtccc
ccgctctgtctcaacggcaacttctcgctcaagcaggactcgtcccccgatcacgagaag
agctaccactactctatgcactactcggcgctgcccggctcccggcccgcgggccacggg
ctggtcttcggctcgtcggccgtgcgcgggggcgtccactcggagaatctcttgtcttac
gatatgcaccttcaccacgatcggggccccatgtacgaggagctcaacgcgtttttccat
aactga

DBGET integrated database retrieval system