KEGG   Rattus norvegicus (rat): 54278Help
Entry
54278             CDS       T01003                                 

Gene name
Nr4a2, Nurr1
Definition
(RefSeq) nuclear receptor subfamily 4, group A, member 2
  KO
K08558  nuclear receptor subfamily 4 group A member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04925  Aldosterone synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    54278 (Nr4a2)
   04925 Aldosterone synthesis and secretion
    54278 (Nr4a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    54278 (Nr4a2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    54278 (Nr4a2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 nerve growth factor IB-like
    54278 (Nr4a2)
Nuclear receptors [BR:rno03310]
 4. Nerve growth factor IB like
  4A. Nerve growth factor IB like receptor
   54278 (Nr4a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 54278
NCBI-ProteinID: NP_062201
RGD: 3202
Ensembl: ENSRNOG00000005600
UniProt: Q07917 A0A0G2JSV4 Q3LZI5
Position
3q21
AA seq 598 aa AA seqDB search
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSV
YYKPSSPPTPSTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQDPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGW
AEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtgttcaggcgcagtatgggtcctcgcctcaaggagccagccccgcttctcag
agctacagttaccactcttcgggagaatacagctccgatttcttaactccagagtttgtc
aagtttagcatggacctcaccaacactgaaattactgccaccacttctctccccagcttc
agtacctttatggacaactacagcacaggctacgacgtcaagccaccttgcttgtaccaa
atgcccctgtccggacagcagtcctccattaaggtagaagacattcagatgcacaactac
cagcaacacagccacctgccccctcagtccgaggagatgatgccacacagcgggtcggtt
tactacaagccctcttcgcccccgacacccagcaccccgggcttccaggtgcagcatagc
ccgatgtgggacgatccgggctcccttcacaacttccaccagaactacgtggccactacg
catatgatcgagcagaggaagacacctgtctcccgcctttcactcttctcctttaagcag
tcgcccccgggcactcctgtgtctagctgccagatgcgctttgacgggcctctgcacgtc
cccatgaacccggagcccgcgggcagccaccacgtagtggatgggcagaccttcgccgtg
cccaatcccattcgcaagccggcatccatgggcttcccgggcctgcagatcggccacgcg
tcgcagttgcttgacacgcaggtgccctcgccgccgtcccggggctctccctccaatgag
ggtctgtgcgctgtttgcggtgacaacgcggcctgtcagcattacggtgttcgcacttgt
gagggctgcaaaggtttctttaagcgcacggtgcaaaaaaacgcgaaatatgtgtgttta
gcaaataaaaattgcccagtggataagcgccgccgaaatcgttgtcagtactgtcggttt
cagaagtgcctggctgttgggatggttaaagaagtggttcgcacggacagtttaaaaggc
cggagaggtcgtctaccctcaaaaccgaagagcccacaggatccctctcccccctcacct
ccggtgagtctgatcagtgccctcgtcagagcccacgtcgactccaatccggcaatgacc
agcctggactattccaggttccaggcaaaccctgactatcagatgagtggagatgatact
caacatatccagcagttctacgatctcctgactggctctatggagatcatcagagggtgg
gcagagaagattcctggctttgctgacctgcccaaagccgatcaggacctgctttttgaa
tcagctttcttagaattatttgttctacgcttagcatacaggtccaacccagtggagggt
aaactcatcttttgcaatggggtggtcttgcacaggttgcaatgcgtgcgtggctttggg
gaatggattgattccattgttgaattctcctccaacttgcagaatatgaacatcgacatt
tctgccttctcctgcattgctgccctggctatggtcacagagagacacgggctcaaggaa
cccaagagagtggaagagctacaaaacaaaattgtaaattgtcttaaagaccatgtgact
ttcaataatgggggattgaaccgacccaactacctgtccaaactgttggggaagctccca
gaacttcgcaccctttgcacacaggggctccagcgcattttctacctgaaattggaagac
ttggtaccaccaccagcaataattgacaaacttttcctggacaccttacctttctaa

DBGET integrated database retrieval system