KEGG   Rattus norvegicus (rat): 54284
Entry
54284             CDS       T01003                                 

Gene name
Pitx2
Definition
(RefSeq) pituitary homeobox 2 isoform 1
  KO
K04686  paired-like homeodomain transcription factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    54284 (Pitx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    54284 (Pitx2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    54284 (Pitx2)
SSDB
Motif
Pfam: Homeodomain OAR Homeobox_KN XRCC4
Other DBs
NCBI-GeneID: 54284
NCBI-ProteinID: NP_001035970
RGD: 3331
Ensembl: ENSRNOG00000010681
UniProt: Q9R0W1
Position
2
AA seq 324 aa
MNCMKGPLPLEHRAAGTKLSAASSPFCHHTQALAMASVLAPGQPRSLDASKHRLEVHTIS
DTSSPEVAEKDKGQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMS
TREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPG
YSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTG
VPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS
FGYASVQNPASNLSACQYAVDRPV
NT seq 975 nt   +upstreamnt  +downstreamnt
atgaactgcatgaaaggcccgctgcccttggagcaccgagcagccgggactaagctgtcg
gccgcttcctcacccttctgtcaccatacccaggcgttagccatggcttcggtcctagct
cctggtcagccccgctccctggacgcctccaaacatagactggaggtgcatacaatctcc
gatacgtccagccctgaagtcgcagagaaagataagggccagcagggaaagaatgaggat
gtgggcgcagaggacccgtccaagaagaagcggcaacgccggcagaggactcactttact
agtcagcagctccaggagctggaagccactttccagagaaaccgctacccagacatgtcc
actcgcgaagaaatcgccgtgtggaccaaccttacggaagcccgagtccgggtttggttc
aagaatcgccgggccaaatggagaaagcgggagcgcaaccagcaggccgagctgtgtaag
aatggcttcgggccgcagttcaatgggctcatgcagccgtacgatgacatgtaccccggc
tactcgtacaacaattgggctgccaagggcctcacgtcagcgtctctgtccaccaagagc
ttccccttcttcaactctatgaacgtcaatcccctatcctcccagagcatgttttccccg
cccaactccatctcatccatgagtatgtcgtccagcatggtgccgtccgcggtgaccggc
gtcccgggctccagcctcaatagcctgaataacttgaacaacctgagcagcccgtcgctg
aattccgcggtgcccacgcccgcctgtccttacgcgccgccgactcctccgtacgtttat
agggacacatgtaactcgagcctggccagtctgagactaaaagcaaagcaacactccagc
ttcggctacgccagcgtgcagaacccggcctccaacctgagcgcttgccagtatgcggtc
gaccggccggtgtga

DBGET integrated database retrieval system