KEGG   Rattus norvegicus (rat): 54287
Entry
54287             CDS       T01003                                 

Gene name
Eif2ak2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04217  Necroptosis
rno05010  Alzheimer disease
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05171  Coronavirus disease - COVID-19
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54287 (Eif2ak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    54287 (Eif2ak2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    54287 (Eif2ak2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    54287 (Eif2ak2)
   05171 Coronavirus disease - COVID-19
    54287 (Eif2ak2)
   05164 Influenza A
    54287 (Eif2ak2)
   05162 Measles
    54287 (Eif2ak2)
   05168 Herpes simplex virus 1 infection
    54287 (Eif2ak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54287 (Eif2ak2)
   05169 Epstein-Barr virus infection
    54287 (Eif2ak2)
   05165 Human papillomavirus infection
    54287 (Eif2ak2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54287 (Eif2ak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    54287 (Eif2ak2)
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    54287 (Eif2ak2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    54287 (Eif2ak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     54287 (Eif2ak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   54287 (Eif2ak2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54287 (Eif2ak2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     54287 (Eif2ak2)
SSDB
Motif
Pfam: Pkinase dsrm PK_Tyr_Ser-Thr ABC1 Pkinase_fungal FTA2 Kinase-like Haspin_kinase DND1_DSRM Kdo APH RIO1 SR-25
Other DBs
NCBI-GeneID: 54287
NCBI-ProteinID: NP_062208
RGD: 3402
Ensembl: ENSRNOG00000048315
UniProt: Q63184
Position
6
AA seq 513 aa
MASDTPGFYVDKLNKYSQIHKVKIIYKEISVTGPPHDRRFTFQVIIEEREFPEGEGRSKQ
EAKNNAAKLAVEILDNENKVDSHTDASEQGLIEGNYIGLVNSFAQKENLPVNFELCDPDS
QLPHRFICKCKIGQTTYGTGFGANKKEAKQLAAKNAYQKLSEKSPSKTGFVTSLSSDFSS
SSSITSNSASQSASGRDFEDIFMNGLREKRKSGVKVPSDDVLRNKYTLDDRFSKDFEDIE
EIGSGGFGQVFKAKHRIDGKTYAIKRITYNTKKAKREVQALAELNHANIVQYRVCWEGED
YDYDPENSTNGDTSRYKTRCLFIQMEFCDKGTLQQWLEKRNRSQEDKALVLELFEQIVTG
VDYIHSKGLIHRDLKPGNIFLVDEKHIKIGDFGLATALENDGNPRTKYTGTPQYMSPEQK
SSLVEYGKEVDIFALGLILAELLHICKTDSEKIEFFQLLRNGVFSDDIFDNKEKSLLQKL
LSSKPRERPNTSEILKTLAEWKNISEKKKRNTC
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggccagtgatacaccaggtttctacgtggacaaacttaacaaatactcccagatacac
aaagtaaagattatatataaagaaatttctgttacaggacctccacacgacagaaggttt
acatttcaagttataatagaagagagggaatttccagaaggtgaaggtagatcaaagcag
gaggcgaaaaataatgctgccaaattagctgtcgaaatacttgataatgaaaacaaggtg
gatagtcacacggatgcttctgaacaaggtttaatagaggggaactacattggccttgtc
aattcttttgcccagaaggaaaatctgcctgtaaattttgaactgtgtgaccccgactcc
caattgcctcacagatttatttgtaaatgcaaaatcgggcagactacgtatggtactggt
tttggcgctaacaaaaaggaggcaaagcagttggctgccaaaaatgcgtatcagaagctg
tcagagaaaagcccatcgaaaactggctttgtcacatctttatccagtgacttttccagc
agctcgtctataacaagtaactctgcttctcagtcagcatctggaagggatttcgaggac
atatttatgaatggtctcagagaaaaaaggaaatcaggagtaaaagtgccatctgatgac
gtgctaagaaataaatataccttggacgacaggtttagcaaagattttgaagacatagaa
gaaattggctcgggtggatttggccaagttttcaaagcaaaacacagaatcgatggaaag
acgtatgctattaagcgcattacatataacaccaagaaggcaaagcgtgaagtacaagca
ctagcagaactcaatcacgccaacattgttcaataccgagtttgttgggagggagaggac
tatgactatgatcccgagaacagcacaaacggtgacacaagtcgatacaagacccggtgc
ctctttatccaaatggaattctgtgataaaggaactctgcagcagtggttggaaaagaga
aatcggagtcaagaggacaaggctttggttttggagttatttgaacaaatagtgacagga
gtggattatatacactcgaaaggtttaattcatagagaccttaagccaggtaatatattt
ttagtggatgaaaaacacattaagatcggagactttggccttgcaacagccctggaaaat
gatggaaatcctcgaacaaagtatacaggaactcctcaatacatgagtccagaacaaaag
tcatcgttagtggaatatggaaaggaagtggacatctttgctttgggccttattctagct
gaacttcttcacatatgcaaaactgattcagagaaaatagagtttttccaacttctaaga
aatggcgtcttctccgatgatattttcgacaacaaggaaaaaagtcttctacagaaatta
ctctcaagtaaacccagggaacgacccaatacgtctgaaatcctgaagactttggctgag
tggaagaacatctcggagaaaaagaaaagaaacacgtgttag

DBGET integrated database retrieval system