KEGG   Rattus norvegicus (rat): 54300
Entry
54300             CDS       T01003                                 

Gene name
Slc12a3, NCC, TSC
Definition
(RefSeq) solute carrier family 12 member 3
  KO
K14426  solute carrier family 12 (sodium/chloride transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    54300 (Slc12a3)
   04147 Exosome [BR:rno04147]
    54300 (Slc12a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   54300 (Slc12a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   54300 (Slc12a3)
SSDB
Motif
Pfam: AA_permease SLC12 AA_permease_N AA_permease_2
Other DBs
NCBI-GeneID: 54300
NCBI-ProteinID: NP_062218
RGD: 3686
Ensembl: ENSRNOG00000057072
UniProt: P55018 G3V8G0
Position
19p13-p12
AA seq 1002 aa
MAELPVTEMPGDALCSGRFTISTLLGGDEPPPAACDNSQPSHLTHGSTLYLRTFGYNTID
VVPAYEHYANSALPGEPRKVRPTLADLHSFLKQEGSHLHALAFDGRPGHELTDGLVEDET
GANSEKSPGEPVRFGWVKGVMIRCMLNIWGVILYLRLPWITAQAGIVLTWLIILLSVMVT
SITGLSISAISTNGKVKSGGTYFLISRSLGPELGGSIGLIFAFANAVGVAMHTVGFAETV
RDLLQENGTPIVDPINDIRIIGVVTVTVLLAISLAGMEWESKAQVLFFLVIMVSFANYLV
GTLIPASKDKASKGFYSYHGDIFVQNLVPDWRGIDGSFFGMFSIFFPSATGILAGANISG
DLKDPAVAIPKGTLMAIFWTTISYLAISATIGSCVVRDASGDVNDTVTPGPGLCEGLACG
YGWNFTECSQQHSCRYGLINYYQTMSMVSAFAPLITAGIFGATLSSALACLVSAAKVFQC
LCEDQLYPLIGFFGKGYGKNKEPVRGYLLAYAIAVAFIIIAELNTIAPIISNFFLCSYAL
INFSCFHASITNSPGWRPSFRYYSKWAALFGAVISVVIMFLLTWWAALIAIGVVLFLLLY
VIYKKPEVNWGSSVQAGSYNLALSYSVGLNEVEDHIKNYRPQCLVLTGPPNFRPALVDFV
STFTQNLSLMICGHVLIAPGKQRVPELRLIASGHTKWLNKRKIKAFYSDVIAEDLRSGVQ
ILMQASGLGRMKPNILVVGFKKNWQSAHPATLEDYIGILHDAFDFNYGVCIMRMREGLNV
SEALQTHTAPEALVQEEQTSTIFQSEQGKKTIDIYWLFDDGGLTLLIPYLLHRKKRWGKC
KIRVFVGGQINRMDEERKAIISLLSKFRLGFHEVHVLPDINQKPQVEHTKRFEDMIAPFR
LNDGFKDEATVAEMRRDYPWKISDEEINKNRIKSLRQVRLNEILLDYSRDAALIILTLPI
GRKGKCPSSLYMAWLETLSQDLSPPVLLIRGNQENVLTFYCQ
NT seq 3009 nt   +upstreamnt  +downstreamnt
atggcagagctacccgtgacagagatgccaggcgatgctctgtgcagtgggcgcttcacc
atcagcacgctgctggggggtgacgagcccccaccagctgcctgtgacaatagccagccc
agccatttgacccatggcagcaccttgtacctacgcacctttggttacaacactatagat
gtggtacccgcctacgaacactacgctaacagcgctctgcccggcgagccccggaaggtg
cggcccaccctggctgacctgcactcgttcctcaagcaggaaggtagccacctgcatgcc
ctggcctttgatggacggccaggccatgagctgactgatggacttgtggaagacgagaca
ggcgccaacagcgagaagagccctggagaacctgtgcgtttcggctgggtcaagggagtg
atgatccgatgcatgctcaacatatggggtgtgatcctctatctgcggctgccctggatt
acggcgcaggcgggcattgtcctgacctggctcatcatcctgctgtcagtcatggtgaca
tctatcaccggcctctctatctcggccatctccaccaatggcaaggtcaagtcgggtggt
acctatttcctaatttctcggagtctgggacctgagctggggggctccattggcctcatc
ttcgcctttgccaatgccgtgggtgtggccatgcacactgtgggctttgcagagaccgta
cgagacctacttcaggagaacggcacacccattgtagaccccatcaatgacatccgcatc
atcggtgtggtcacggtcactgtgctgctggccatctcgctggctgggatggagtgggag
tccaaggcccaggtgctgttctttcttgtcatcatggtctcttttgccaactacctggtg
ggcacgctgatcccagcatctaaggacaaagcctccaaaggtttctacagctaccatggg
gacatttttgttcagaacctggtacccgactggagaggcatcgatggtagcttcttcggg
atgttctccatcttcttcccttcagccacaggcattctggcaggggccaacatctctggg
gacctcaaggaccctgctgtcgctattcccaagggaacactcatggccattttctggacc
accatttcctaccttgccatctcggccaccatcgggtcctgtgtggtgagggatgcctct
ggggacgtgaacgacaccgtaactcctggcccaggcctctgtgaagggctagcctgcggt
tatggctggaacttcacggaatgctcccagcagcacagctgccgctatggcctcatcaac
tactaccagaccatgagcatggtgtctgccttcgcacccctgatcacagccggcatcttt
ggggccaccctgtcctcggccttggcctgtcttgtctcagctgccaaggtcttccagtgc
ctgtgcgaagaccagctgtaccctctgattggcttctttggcaagggctatgggaagaac
aaggaacctgtgcgtggctacttgctggcctacgccatcgcggtggccttcatcatcatt
gctgagctcaacaccatcgctcccatcatttctaacttcttcctctgctcctacgccctc
atcaacttcagctgcttccatgcctccatcaccaactcacctggatggagaccctccttc
cgatactacagcaagtgggcggcgctgtttggggcagtgatctccgtggtcatcatgttc
ctgcttacctggtgggcagctctcattgccattggagtcgttctcttcctcctgctctat
gtgatctacaagaagccagaggtaaactggggctcctcagtgcaggctggctcctacaac
ctggccctgagctactccgtgggcctcaatgaggtggaagaccacatcaagaactatcgc
ccccagtgcctggtgcttacaggaccccccaacttccgcccagctcttgtggactttgtg
agcacgtttacccagaacctaagcctgatgatctgtggccacgtgctcattgcacccggc
aaacagagagtgccggagctccgactcatcgccagcggacacaccaagtggctgaacaag
aggaagatcaaggccttctactctgacgtcatagctgaggacttgcgcagtggcgtccag
attctcatgcaggcctcgggtctgggaagaatgaaacctaacattctggtggttggcttc
aagaagaactggcagtctgcccacccagccacactggaggactacattggcatcctgcac
gatgcctttgacttcaactacggggtgtgcatcatgaggatgcgtgaggggctcaatgtc
tctgaggcgctgcagacgcacacagccccagaggcactggtacaggaggagcagaccagc
accatcttccagtcggagcaaggcaagaagaccattgacatctactggctgtttgacgat
ggaggcctcaccctcctcatcccttatctcctgcaccgcaagaagagatggggcaaatgc
aagatccgcgtgttcgttgggggccagatcaacaggatggatgaagagagaaaggcgatc
atttctctgttgagcaagttcagactgggattccatgaagtccacgtccttcctgacatc
aaccagaagccccaggtggagcacaccaagcggtttgaggacatgattgcccccttccgt
ctcaatgacggcttcaaggacgaggccactgttgccgagatgaggagggactatccctgg
aagatctcagacgaggagattaataagaacagaattaagtcccttcggcaggtgaggctg
aatgagattctcctggattactcccgggatgctgctctgatcatccttaccttgcccatt
ggaaggaaggggaagtgccccagttcactgtacatggcctggctggagaccctgtcccag
gacctcagtcctcccgttctcctcatccgaggtaaccaggagaacgtgctcaccttttac
tgccagtga

DBGET integrated database retrieval system