KEGG   Rattus norvegicus (rat): 54302
Entry
54302             CDS       T01003                                 

Gene name
Slc14a2, Slc14a2T, Slc14a2_v4, UrT1-C, UrT1-D, testSymbol
Definition
(RefSeq) solute carrier family 14 member 2
  KO
K08716  solute carrier family 14 (urea transporter)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    54302 (Slc14a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC14: Urea transporter
   54302 (Slc14a2)
SSDB
Motif
Pfam: UT
Other DBs
NCBI-GeneID: 54302
NCBI-ProteinID: NP_062220
RGD: 3689
Ensembl: ENSRNOG00000056021 ENSRNOG00000061714
UniProt: Q62668
Position
18q12.3
AA seq 929 aa
MSDHPLKEMSDNNRSPLLPEPLSSRYKLYESELSSPTWPSSSQDTHPALPLLEMPEEKDL
RSSDEDSHIVKIEKPNERSKRRESELPRRASAGRGGFSLFQAVSYLTGDMKECKNWLKDK
PLVLQFLDWVLRGAAQVMFVNNPLSGLIIFIGLLIQNPWWTIAGALGTVVSTLAALALSQ
DRSAIASGLHGYNGMLVGLLVAVFSEKLDYYWWLLFPVTFASMACPVISSALSTVFAKWD
LPVFTLPFNIALTLYLAATGHYNLFFPTTLVKPASSAPNITWSEIEMPLLLQTIPVGVGQ
VYGCDNPWTGGVILVALFISSPLICLHAAIGSIVGLLAALTVATPFETIYTGLWSYNCVL
SCVAIGGMFYVLTWQTHLLALVCALFCAYTGAALSNMMAVVGVPPGTWAFCLSTLTFLLL
TSNNPGIHKLPLSKVTYPEANRIYFLTAKRSDEQKPPNGGGGEQSHGGGQRKAEEGSETV
FPRRKSVFHIEWSSIRRRSKVFGKSEHQERQTKEPLPYLYRKPTVELLDLNTMEESSEIK
VETNTTRTTWIQSSMIAGGKRVSKALSYITGEMKECGEGLKDKSPVFQFLDWVLRGTSQV
MFVNNPLSGILIVLGLFVQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGLHGYNGVLV
GLLMAVFSDKGNYYWWLLLPVIVMSMTCPILSSALSTVFSKWDLPVFTLPFNIAVTLYLA
ATGHYNLFFPTKLLQPAVTTPNITWSDVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLVAL
FVSSPLICLHAAIGSTIGMLAALSIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTH
LLAIACALFAAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPGIYKLPLSKVTY
PEANRIYFLSQEKNRRASMITKYQAYDVS
NT seq 2790 nt   +upstreamnt  +downstreamnt
atgagcgaccatcccctgaaggagatgtctgacaacaaccgcagccccctcttgccagag
cctctttccagcagatacaagttgtatgagtcagagctaagcagccctacctggccttca
agctcccaggatacacacccagcccttcccctgctggaaatgcctgaagaaaaggatctc
cgatcatcggatgaagacagccacatagtgaagattgaaaagcccaacgagcggagtaaa
cggagagaaagcgagttgccccgcagggcttctgcaggccggggaggcttcagcctcttc
caagctgtgagctacctcactggtgacatgaaggaatgcaagaactggctgaaagataag
cccctggtccttcagttcctagactgggtcctgcggggagcagctcaggtgatgtttgtc
aacaacccccttagtgggctcatcatcttcatagggctcctgatccagaatccctggtgg
acgattgctggggcactggggacagtggtctcaaccttggctgcccttgccttgagccag
gacaggtcagccatcgcctctggactccatgggtacaacgggatgctggtgggactcctg
gtggctgtcttctcagagaagttagactactactggtggcttctgtttcctgtgaccttc
gcatccatggcctgcccagttatttctagtgccttgagcaccgtcttcgccaagtgggac
ctgccagtcttcacactgcccttcaacatcgccttaacactgtacctggcagctacgggc
cactacaaccttttcttccccacgacgcttgtgaagcctgcgtcttcagcgcccaacatc
acctggtcagagattgagatgcctttgctgttacaaaccatccccgttggggtgggccag
gtctacggctgtgacaacccctggacaggcggcgtgatcctggtggctctgtttatctcc
tctcccctcatctgtttgcacgcagccataggatccattgtggggctgctggcagcactg
acggtggccactcccttcgagacgatctacacgggcctttggagctacaactgtgtcctc
tcctgtgtcgccattggaggcatgttctacgtactcacctggcagacacacctgttggca
cttgtctgtgccctgttctgtgcgtacacgggagcggccctctccaatatgatggcagtg
gttggtgtgccaccgggcacctgggccttctgtctctccaccctcaccttccttctcctc
acaagcaacaaccctggcatccacaagctcccactcagcaaagtcacctacccagaggcc
aaccgcatctacttcctgacagcgaaacgcagtgacgagcagaagccccccaatggtggc
ggtggagaacagtcacacggaggaggccagcggaaggcagaggagggctccgagaccgtg
ttccccaggcgtaagagcgtgttccatatcgagtggtcatccatccggaggaggagcaaa
gtgtttggaaaaagtgaacaccaagagagacaaaccaaagagccactcccctacctgtat
cggaagcccacagtggaactcttggacctgaacaccatggaggagagctctgagataaag
gtagaaaccaacacaaccaggactacctggatccagagctccatgatcgctggggggaag
agagtcagcaaagccctcagctacatcacaggagagatgaaggagtgcggcgagggactt
aaagacaaatctccagtgttccagtttcttgactgggtgctccgaggcacgtctcaggtg
atgtttgtgaacaaccctctcagtggcatcctcatcgttcttggcctcttcgtgcagaat
ccctggtgggccatctccggttgcttgggcaccatcatgtccaccttgactgccctcatc
ctgagccaggacaagtcggccattgcagcaggactccatggctacaatggggtgcttgtg
gggctcctgatggccgtgttctcagacaagggcaattactactggtggctgctgctcccg
gtcatcgtcatgtccatgacttgccccatcctctccagtgctctgagcaccgtcttcagc
aaatgggacctcccagtcttcacactgcccttcaacatcgccgtgaccctgtacctggca
gccacgggccactacaatctcttcttccccacgaagctgctgcagcctgcagttaccaca
cccaacatcacctggtcagatgtccaagtgcctttgcttctgagagccatccccgttgga
atcggccaagtgtatggctgtgacaatccctggactggaggcatcttcctcgttgctctg
ttcgtctcttcacctctcatctgcttgcacgctgccatcggatccacgatagggatgtta
gcagcactcagcattgccacaccatttgactccatctactttggcctgtgtggcttcaat
agcactctggcctgtatcgctattggtggcatgttctacgtcatcacctggcagacgcac
ctgctcgccattgcctgtgccctgtttgcagcctacctgggtgctgccctggccaacatg
ctgtctgtgtttggattaccaccctgcacctggcccttctgcctctcagcgctcaccttc
ctcctcctcacaaccaacaaccctggcatctacaagctcccgctcagcaaagtcacctac
ccagaggccaaccgcatctacttcctgtcccaggagaaaaacagaagggcatcgatgata
acaaagtaccaggcctacgacgtctcctaa

DBGET integrated database retrieval system