KEGG   Rattus norvegicus (rat): 54305
Entry
54305             CDS       T01003                                 

Gene name
Sstr2, Smstr2
Definition
(RefSeq) somatostatin receptor 2
  KO
K04218  somatostatin receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04935  Growth hormone synthesis, secretion and action
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    54305 (Sstr2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    54305 (Sstr2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    54305 (Sstr2)
  09154 Digestive system
   04971 Gastric acid secretion
    54305 (Sstr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    54305 (Sstr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Somatostatin
    54305 (Sstr2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv FtsK_4TM
Other DBs
NCBI-GeneID: 54305
NCBI-ProteinID: NP_062221
RGD: 3763
Ensembl: ENSRNOG00000002793
UniProt: P30680
Position
10q32.1
AA seq 369 aa
MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggagttgacctctgagcagttcaatgggagccaagtgtggataccttctccctttgac
ctcaacggctcactggggccaagcaatggctccaaccagacagagccatactacgacatg
acaagcaacgcggtcctcacgttcatctacttcgtggtgtgcgtggtggggctgtgcggc
aacacgctcgtcatctacgtcatcctccgctacgccaagatgaaaaccatcaccaacatt
tacatcctcaacctggccatcgcagatgaactcttcatgctggggctgcccttcttggcc
atgcaggtggcgctggtccactggccttttggcaaggccatctgccgggtggtcatgact
gtggacggtatcaaccagttcaccagtatcttctgcttgacggtcatgagcatcgaccgt
tacctggccgtggtccaccccattaagtcagccaaatggaggcgaccccggacagccaag
atgatcaacgtggctgtgtggggtgtgtccctgcttgtcattttgcccatcatgatatac
gctggcctccggagcaaccagtggggtaggagcagctgcaccatcaactggccgggcgaa
tccggggcatggtacacgggtttcattatctatgccttcatcctggggttcctggtaccc
ctaaccatcatctgtctctgctacctgttcatcatcatcaaggtgaagtcctctgggatc
cgagtggggtcgtccaagaggaaaaagtcagagaaaaaggtgacccgaatggtatccatc
gtggtggctgtcttcatcttctgctggctccccttctatatcttcaatgtctcgtccgtg
tctgtggccatcagccccacccctgccctgaaaggcatgtttgactttgtggttatcctc
acctacgccaacagctgcgccaaccccatcctgtacgccttcttgtccgacaacttcaag
aagagcttccagaatgttctttgcttggtcaaggtgagtggtgcggaggatggggagcgg
agcgacagtaagcaggacaaatcccggctgaatgagaccacggagacccagaggaccctc
ctcaatggagacctccaaaccagtatctga

DBGET integrated database retrieval system