KEGG   Rattus norvegicus (rat): 54318
Entry
54318             CDS       T01003                                 

Gene name
Eif2s1
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit 1
  KO
K03237  translation initiation factor 2 subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno04140  Autophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04210  Apoptosis
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05160  Hepatitis C
rno05162  Measles
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    54318 (Eif2s1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    54318 (Eif2s1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    54318 (Eif2s1)
  09143 Cell growth and death
   04210 Apoptosis
    54318 (Eif2s1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    54318 (Eif2s1)
   05164 Influenza A
    54318 (Eif2s1)
   05162 Measles
    54318 (Eif2s1)
   05168 Herpes simplex virus 1 infection
    54318 (Eif2s1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54318 (Eif2s1)
   05012 Parkinson disease
    54318 (Eif2s1)
   05014 Amyotrophic lateral sclerosis
    54318 (Eif2s1)
   05020 Prion disease
    54318 (Eif2s1)
   05022 Pathways of neurodegeneration - multiple diseases
    54318 (Eif2s1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    54318 (Eif2s1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    54318 (Eif2s1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rno03012]
    54318 (Eif2s1)
Translation factors [BR:rno03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    54318 (Eif2s1)
SSDB
Motif
Pfam: EIF_2_alpha S1 DUF4453
Other DBs
NCBI-GeneID: 54318
NCBI-ProteinID: NP_062229
RGD: 620963
Ensembl: ENSRNOG00000009432
UniProt: P68101
Position
6
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtcgaagatgtagtg
atggtgaatgtaagatccattgctgaaatgggggcctatgtcagcttgttggaatataat
aacattgaaggcatgattcttcttagtgaattatccagacgacgtatccgttctataaac
aaactgatccgaattggcagaaatgaatgtgtagttgtcattagagtggataaagaaaaa
ggatatatagatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgccatgttgctgaggtattagag
tataccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcctttaagcatgcagtctcagaccca
tctatcttggatagtttagatttgaatgaagatgaaagagaagtactcattaacaatatc
aataggcgtttgaccccacaagctgtcaagattcgagcagatattgaggtagcttgctat
ggttacgaaggcattgatgctgtaaaagaagccctgagagcaggtttgaattgttctaca
gaaaccatgcccatcaagattaatctaatagctccacccaggtatgtgatgacaacaacg
accctagagaggacagaaggactctctgttctcaatcaggctatggcagtcatcaaagaa
aagattgaggagaagaggggagtgttcaatgttcagatggagcccaaagtggttacagat
acagatgagactgaacttgcaaggcagctggaacggcttgagagagaaaatgcagaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system