KEGG   Rattus norvegicus (rat): 54320
Entry
54320             CDS       T01003                                 

Gene name
Pdpn, E11, Gp38, OTS-8, RTI40, T1-alpha
Definition
(RefSeq) podoplanin
  KO
K16778  podoplanin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    54320 (Pdpn)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    54320 (Pdpn)
SSDB
Motif
Pfam: Podoplanin TMEM154 Endomucin Glycophorin_A Peptidase_M56 DUF4690
Other DBs
NCBI-GeneID: 54320
NCBI-ProteinID: NP_062231
RGD: 61819
Ensembl: ENSRNOG00000014961
UniProt: Q64294
Position
5q36
AA seq 166 aa
MWTAPVLLWVLGSVWFWDSAQGGAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELD
KSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGE
TQTTDKKDGLAVVTLVGIIIGVLLAIGFIGGIIIVVMRKISGRFSP
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtggaccgcgccagtgttgctctgggttttggggagcgtttggttctgggactcagcg
cagggaggggccatcggtgcgctagaagatgatcttgtgaccccgggtccaggagatgac
atggtgaacccaggtctagaagacagaatagaaaccacggacactacaggagaactggat
aagtcaactgccaaggcgcctctggtaccaacacagcctcccattgaggaactgccgacc
tcaggaacctccgaccacgatcacaaagaacatgagagtacgaccactgtcaaagcggtg
accagccactccacggacaagaaaacaactcaccccaatagagataacgcaggcggtgaa
acgcagaccacagataagaaagatggcttggctgtagtgaccctggtcggaatcataatt
ggcgtcttgttagccattggcttcattggagggatcatcattgtggttatgaggaagatt
tctggaaggttctcgccctaa

DBGET integrated database retrieval system