KEGG   Rattus norvegicus (rat): 54355
Entry
54355             CDS       T01003                                 

Gene name
Rassf5
Definition
(RefSeq) ras association domain-containing protein 5
  KO
K08015  Ras association domain-containing protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04218  Cellular senescence
rno04670  Leukocyte transendothelial migration
rno05200  Pathways in cancer
rno05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    54355 (Rassf5)
   04015 Rap1 signaling pathway
    54355 (Rassf5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    54355 (Rassf5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    54355 (Rassf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54355 (Rassf5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    54355 (Rassf5)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2 LexA_DNA_bind PHD
Other DBs
NCBI-GeneID: 54355
NCBI-ProteinID: NP_062238
RGD: 621694
Ensembl: ENSRNOG00000005342
UniProt: O35141
Position
13
AA seq 413 aa
MASPAIGQRPYPLLLDPEPPRYLQSLGGTEPPPPARPRRCIPTALISASGASEGRGSRRN
ARGDPEPTPRDCRHARPVRPGLQQRLRRRPGSHRPRDVRSIFEQPQDPRVLAERGEGHRF
AELALRGGPGWCDLCGREVLRQALRCANCKFTCHPECRSLIQLDCRQKEGPALDRQSPES
TLTPTFNKNVCKAVEETQHPPTIQEIKQKIDSYNSREKHCLGMKLSEDGTYTGFIKVHLK
LRRPVTVPAGIRPQSIYDAIKEVNPAATTDKRTSFYLPLDAIKQLHISSSTTVSEVIQGL
LKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADCPLYLRLLAGPDTDVLSFVLKENETG
DVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQKLEEALRESQGKPG
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcgtccccggccattgggcagcgtccctacccgctgctgctagaccccgagccgccg
cggtatctgcagagcctgggtggcaccgagccgccaccgcccgcccggccgcgtcgctgt
atccccacggccctgatctccgcgtccggggcgtcagagggtcgcggtagcaggaggaat
gcccggggggacccggagcccacgccccgggactgccgacacgctcgccctgtccggccc
ggtctgcagcagagactgcggcggcgacctgggtcgcaccgaccccgcgacgtgaggagc
atcttcgagcaaccgcaggatccccgcgtcttagccgagagaggagagggacaccgtttc
gcggaattggcgctccggggtggcccgggctggtgtgacctgtgcggacgagaggtgctg
cggcaggcgctgcgctgcgctaattgtaaattcacctgccacccagagtgccgcagcctg
atccagctggactgcagacagaaggagggccctgccctggacagacagtctccagaaagc
accctcaccccaaccttcaacaagaatgtctgtaaggctgtggaggagacacagcacccg
cccaccatacaggagatcaagcagaagattgacagctataacagccgggagaagcactgc
ctgggcatgaagttgagtgaagatggcacctacacaggtttcatcaaagtgcatttgaaa
ctccgccggccagtgacggtgcctgctgggattcggccccagtccatctatgatgccatt
aaggaagtgaaccctgcagctaccacagacaagcggacatccttctacctgccacttgac
gccatcaagcagctacacattagcagcagcaccactgtcagtgaggtcatccaggggctg
ctcaagaaattcatggttgtggacaacccacagaagtttgccctttttaagcggatacac
aaagatggacaagtgctcttccagaaactctccatcgctgactgccctctctaccttcgt
ctgctcgctggtcctgacaccgacgtgctcagctttgtgctcaaggagaatgaaaccgga
gacgtagagtgggatgccttttccattcctgaactccagaacttcttaactatcctggaa
aaagaggagcaggacaagatccatcaactgcagaagaagtacaacaaattccggcagaaa
ctggaggaggccttacgagagtcccaagggaagcctgggtaa

DBGET integrated database retrieval system