KEGG   Rattus norvegicus (rat): 54705
Entry
54705             CDS       T01003                                 

Gene name
Pdp1, Ppm2c
Definition
(RefSeq) pyruvate dehyrogenase phosphatase catalytic subunit 1
  KO
K01102  pyruvate dehydrogenase phosphatase [EC:3.1.3.43]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    54705 (Pdp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.43  [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase
     54705 (Pdp1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   Pyruvate dehydrogenase phosphatases
    Catalytic subunit
     54705 (Pdp1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 54705
NCBI-ProteinID: NP_001258037
RGD: 620393
Ensembl: ENSRNOG00000016180
UniProt: A0A0G2QC17
Structure
PDB: 
2PNQ

Position
5q13
AA seq 563 aa
MCVCPGPRRIGIPVRTSSLPLFSDAMPAPTQLFFPLVRNCELSRIYGTACYCHHKHLCCS
PPYIPQNRLRYTPHPAYATFCRPRENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYS
FKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQAV
SERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFNSLRTY
WQELIDLNTGESADIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATAC
VAHVDGVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKNEAK
SVVKQDRLLGLLMPFRAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYL
TAEPEVTYHRLRPQDKFLVLATDGLWETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTL
GQMHGLLTERRAKMSSVFEDQNAATHLIRHAVGNNEFGAVDHERLSKMLSLPEELARMYR
DDITIIVVQFNSHVVGAYQNQEQ
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgtgtgtgtgtcccgggcccagacgaattggaatcccggtcagaacatccagtctacca
ctgttctctgatgccatgccagcaccaactcaactgttttttcctctcgtccgtaactgt
gaactgagcagaatctatggcactgcatgttactgccaccacaaacatctctgctgttca
ccaccgtacattcctcagaatcgtctgagatacacaccccatccagcatatgctaccttt
tgtaggccaagggagaactggtggcagtatactcaaggaaggagatatgcttctacgcct
cagaaattttacctcacacctccacaagtcaacagcatccttaaagctaatgaatacagc
ttcaaagtaccagaatttgatggcaaaaatgtcagttccattcttggatttgacagcaat
cagctgcctgcaaatgcacccatagaagaccggagaagtgcagcaacctgcttgcagacc
agagggatgcttttgggcgtttttgatggtcatgcaggctgtgcttgctcccaggcagtc
agtgaaagactcttctattatattgctgtttccttgttaccccatgagactttgctagag
attgaaaatgcagtggagagtggtcgggcactgctacctatccttcagtggcacaagcac
cccaatgattacttcagtaaggaggcatccaaattgtatttcaacagcttgaggacttac
tggcaagagcttatagacctcaatactggagaatcagctgatattgatgttaaggaggct
ttaattaatgctttcaagagacttgataatgacatttcattggaggctcaagtcggtgat
cctaattcttttctcaattacctggtgcttcgggtagcattttctggggctactgcttgt
gtggcccatgtagatggtgttgacctccatgtggctaacactggcgatagtagagccatg
ctaggtgtgcaagaagaagatggctcctggtcagcagtcacgctctctaatgaccacaat
gctcagaatgaaagagaactagaacgtctaaaactggaacacccaaaaaatgaggccaag
agcgtggtaaagcaggatcggctgcttggcttgctgatgccctttagggcttttggggat
gtaaagttcaaatggagcattgaccttcaaaagagagtgatagagtctggcccagaccag
ttgaatgacaatgaatacaccaagtttatccctcctaactatcatacacctccttatctc
actgctgagccagaggtaacttatcaccgattaaggccacaggataaattcctagtgtta
gcaactgatggattgtgggagactatgcatagacaggatgtggttaggattgtgggtgag
tacttaactggtatgcatcaccaacagccaatagctgttggtgggtacaaggtgactctg
ggacagatgcatggccttttaacagaaaggagagcaaagatgtcatcagtctttgaggat
cagaatgcagcaacccatctcattcgccatgctgtaggcaataatgaatttggagctgtt
gatcatgaacgactctctaaaatgcttagccttcctgaagagcttgctcggatgtataga
gatgacattacaatcattgtagttcagttcaattctcatgttgtaggagcatatcaaaac
caggaacagtaa

DBGET integrated database retrieval system