KEGG   Rattus norvegicus (rat): 548326Help
Entry
548326            CDS       T01003                                 

Gene name
Fcmr, Faim3, Toso
Definition
(RefSeq) Fc fragment of IgM receptor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: V-set
Motif
Other DBs
NCBI-GeneID: 548326
NCBI-ProteinID: NP_001014843
RGD: 1359282
Ensembl: ENSRNOG00000004441
UniProt: Q5M871
Position
13q13
AA seq 426 aa AA seqDB search
MNLWLWLLYFLPVSGTLKVLPEVRLEVELGGSVFIECPLPQTHVRMYLCRQMTNPAICAT
VVSNIFVKKEYKRRVTLKPSLNKKLFLVEMTQLTKDDEGIYACGVGTNTDLGKTQKVTLN
VRNEFPEYPEPFWDDEPTSEPSPRWWLHRYPEELPWLKMGEHASPSGFIDKVTTLSPKTE
APPVHQPSTNTSVSRHPRVYGASSETPTKPSALLPATTAFKTSARQASRLLEASYSHHTR
LHGERTPHYGSQYGREDRGLHISIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRAFSRR
VGRMARRMRGRGPSRQIPTQRRDAPQRPRSQNNVYSACPRRAREPDNVGSAEALLLNAPA
SAPPALPLVIETSWPHTPSLKMSCEYVSLGHQPAVNVEDQDSNDYINIPGLPHLPSKPPG
PRPSRQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttggctttggttactctacttcctgccagtgtctgggaccctgaaggtcctc
ccagaagtacggctggaagtagagttgggtgggtccgttttcatcgagtgcccactccct
caaacacacgtgaggatgtatctgtgccggcagatgaccaaccctgcaatatgcgccact
gtggtgtccaacatctttgtcaagaaggaatataaaaggcgggtcaccctgaagccatcc
ttgaataagaagctgttcctagtggagatgacacagctgactaaggatgacgaaggaatc
tatgcctgtggtgtgggcacaaacacagacctcggcaagacccagaaagtcaccctgaac
gtccgtaatgaattcccagaatacccagagccattctgggacgatgaaccgacatcagag
ccatcgccaagatggtggttgcacagatatccggaggagcttccctggctcaaaatgggt
gaacatgccagcccttctggattcatagacaaagtcaccacactatctccaaagactgag
gcccctccagttcaccagccctccaccaacacttcagtaagccgccatcccagagtttat
ggagcatcttctgaaacacctaccaagccctcagcgctcctgccagctaccacagccttc
aaaacctctgctcggcaagcatccaggctcctcgaggccagctacagccaccacaccaga
cttcatggggaaaggacaccccactacggttcacagtatgggagagaagaccgagggctt
cacatctccatcccagaatttcacattctgattccgaccttcctgggcttcctcttgctg
gttcttttgggactggtggtaaaacgagccattcaaaggaggagagccttctccaggcgc
gtaggccgaatggcgaggagaatgcgaggccgggggccttcccgccagatccctacacag
cgccgggatgccccgcagaggccgcgctcgcagaacaacgtctacagcgcctgcccgcgg
cgcgcacgggaacccgacaacgtgggttcagcggaggctctgctcctcaacgccccagcc
tcggcgcccccagccctgccactggtaattgaaacttcttggccccacaccccgtctctg
aagatgagctgtgaatacgtgagcttgggccaccagcctgctgtcaacgtagaagaccag
gattcaaacgattacatcaatattcctggcctacctcatctccctagcaagcccccaggg
cccagaccttcacgccaatga

DBGET integrated database retrieval system