KEGG   Rattus norvegicus (rat): 56003Help
Entry
56003             CDS       T01003                                 

Gene name
Sept3, Sep3
Definition
(RefSeq) septin 3
  KO
K16938  septin 3/9/12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    56003 (Sept3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    56003 (Sept3)
   04147 Exosome [BR:rno04147]
    56003 (Sept3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     56003 (Sept3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   56003 (Sept3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 GTP_EFTU Roc Dynamin_N AAA_16 AAA_22 ABC_tran Ras FtsK_SpoIIIE AAA_24 NB-ARC G-alpha AAA_29 Sigma54_activat FeoB_N AAA_32 IIGP AAA_7 DUF815
Motif
Other DBs
NCBI-GeneID: 56003
NCBI-ProteinID: NP_062248
RGD: 621745
Ensembl: ENSRNOG00000007686
UniProt: Q9WU34
Position
7q34
AA seq 358 aa AA seqDB search
MSKGLPEARTDTAMSELVPEPRPKPAVPMKPVSINSNLLGCIGIDTIIEQMRKKTMKTGF
DFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGIKMK
LTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISP
TGHSLRPLDLEFMKHLSKVVNVIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKE
FDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALL
RDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagggctcccagaggctaggacggacacagccatgtcagagctggtgcccgag
cccaggcctaagccggcggtgcccatgaagccggtcagcatcaactccaacctactaggc
tgcattggcattgacaccattatcgaacagatgcgcaagaagaccatgaagactggtttt
gacttcaacatcatggtcgttggccagagtggactgggcaagtcgacgctggtcaacaca
ctattcaagtctcaagtgagccggaaggcctccagctggaaccgggaggagaagatcccg
aagacagtggagatcaaagcgattgggcatgtgatagaggaaggtggtatcaaaatgaag
ctgacggtcatcgacacgccaggctttggagaccagatcaacaatgaaaactgctgggag
cccattgagaagtacatcaatgaacagtatgaaaagttcctcaaagaggaggttaatatt
gccaggaagaagcgcatccctgacacccgggtccactgctgcctctacttcatctcccca
acgggacactccttacgaccacttgatcttgagttcatgaaacacctcagcaaagtggtg
aacgtcattcctgtcattgccaaggctgacaccatgaccctggaggagaagtctgaattc
aagcagagggttcgcaaagagcttgaagtaaacggcattgagttctaccctcagaaggag
tttgatgaggatttggaggacaagacagagaatgacaaaatccggcaggagagcatgccc
ttcgcggtggtggggagtgacaaggagtaccaagtgaatggcaagagggtcctcgggaga
aaaacaccctgggggatcatcgaagtcgaaaacctcaaccactgtgagtttgccctgctt
cgagacttcgtcatcaggactcacctccaggacctcaaagaagtaacacacaacatccac
tatgaaacttacagggccaagaggctcaatgacaatggaggcctccctccgggagaaggc
ctcctgggcactgtccttccacctgtgccagccaccccctgccccaccgctgaatga

DBGET integrated database retrieval system