KEGG   Rattus norvegicus (rat): 56042Help
Entry
56042             CDS       T01003                                 

Gene name
Uso1, TAP, Vdp
Definition
(RefSeq) USO1 vesicle transport factor
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Uso1_p115_head Arm_vescicular Uso1_p115_C ArsR Seryl_tRNA_N Atx10homo_assoc SlyX FtsX_ECD Spc7 DUF4407
Motif
Other DBs
NCBI-GeneID: 56042
NCBI-ProteinID: NP_062252
RGD: 621604
Ensembl: ENSRNOG00000002301
UniProt: P41542
Position
14p22
AA seq 959 aa AA seqDB search
MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQ
AMEHLIHVLQTDRSDSEIIAYALDTLYNIISNDEEEEVEENSTRQSEDLGSQFTEIFIKQ
PENVTLLLSLLEEFDFHVRWPGVRLLTSLLKQLGPPVQQIILVSPMGVSKLMDLLADSRE
IIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIITEEGNSDGGIVVEDCLILLQNLL
KNNNSNQNFFKEGSYIQRMKAWFEVGDENPGWSAQKVTNLHLMLQLVRVLVSPTNPPGAT
SSCQKAMFQCGLLQQLCTILMATGIPADILTETINTVSEVIRGCQVNQDYFASVNAPSNP
PRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNEKGQGEIVATLLPSTIDATGNSVS
AGQLLCGGLFSTDSLSNWCAAVALAHALQGNATQKEQLLRVQLATSIGNPPVSLLQQCTN
ILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGL
CALLLGISIYFNDNSLENYTKEKLKQLIEKRIGKENYIEKLGFISKHELYPRASQKPQPN
FPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNVIR
EQDLQLEELKQQVSTLKCQNEQLQTAVTQQASQIQQHKDQYNLLKVQLGKDNHHQGSHSD
GAQVNGIQPEEISRLREEIEELRSHQVLLQSQLAEKDTVIENLRSSQVSGMSEQALATCS
PRDAEQVAELKQELSALKSQLCSQSLEITRLQTENRELQQRAETLAKSVPVEGESELVTA
AKTTDVEGRLSALLQETKELKNEIKALSEERTSIQKQLDSSNSTIAILQTEKDKLYLEVT
DSKKEQDDLLVLLADQDQKILSLKSKLKDLGHPVEEEDESGDQEDDDDELDDGDRDQDI
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcctccgcggggtgatggggggtcagagtgccggaccccagcacacagaagct
gagacgattcagaagctctgtgaccgcgtagcttcatctactttactggacgaccgaaga
aatgctgtccgtgcccttaagtcactgtctaagaaataccgcttggaagtgggaatccaa
gccatggagcatcttatccacgtcttacagacagatcgttcggattctgaaataatagcg
tatgctttggacacactctataatataatatccaatgatgaagaggaagaagtagaagaa
aattctacaagacagagtgaggatttgggaagccaatttacagaaattttcattaagcag
ccagaaaatgtcactctcctgttatctttgttggaggagtttgatttccacgtccgatgg
cctggtgtgagacttctgacttctcttttaaaacagctagggcctccagtgcagcaaatc
atcctagtcagccccatgggtgtttcaaaattaatggacttgctggcagattccagggaa
attatacgtaatgatggcgtcttactactgcaggcattaacaaggagcaacggagcgatc
cagaaaattgttgcttttgaaaatgctttcgagagactactggacattattacagaggag
gggaacagcgatggaggtatagtagtggaagattgtttgattttgctccaaaatttgtta
aaaaacaacaattccaatcaaaatttttttaaagaaggctcttatattcaacgtatgaaa
gcttggtttgaagttggagatgaaaatcctggttggtcagcacagaaagtgaccaatctt
catttaatgctccagcttgtgcgggtactggtgtctcccaccaaccctcccggtgctacc
agtagctgccagaaggccatgttccagtgtgggttactacaacagctttgcactatcctg
atggctaccggaattcctgctgatatcctgactgagaccataaatactgtatcagaagtt
attcgaggctgccaagtaaatcaagactactttgcttctgtgaatgcgccttcaaatccc
ccacgaccggcaatcgttgtgctgctcatgtccatggtcaacgagaggcagccatttgta
ctgcgctgcgccgtgctctactgtttccagtgcttcctctataaaaacgagaaaggacaa
ggagagattgtggccactctgctaccttccactattgacgcaacaggtaactcggtctca
gctggccagctgctctgcggaggtttgttttccacagactccctctcaaactggtgtgct
gccgtggccctcgcccatgcactgcaagggaacgccacccagaaggagcagctgctcagg
gttcagctggccaccagcatcggcaaccccccagtgtcgctcttgcagcagtgcaccaac
attctgtcccagggaagcaagatacagacaagagtcgggttgttgatgttgctttgtacc
tggttaagcaactgtccgattgctgtaacacactttcttcacaactcagccaatgttcca
tttcttacaggacagattgcagaaaatctcggagaagaagagcagttggtccaaggctta
tgtgcccttcttttgggcatttcaatttatttcaacgacaactcactagaaaactacacg
aaagagaaactaaagcaactaatagagaagaggattggcaaagagaattacatagagaaa
cttggatttattagcaagcatgagttatatcccagagcatctcagaaaccccagccaaac
tttccgagtccagaatacatgatatttgatcatgagtttacaaaactggtgaaagaactt
gaaggtgttattaccaaggctatttataagtccagcgaagaagataagaaagaggaagag
gtaaagaaaaccttagaacagcatgataatattgtgactcactataagaatgtgatccgt
gagcaagacctacaactggaggaactaaaacagcaagtgtccacactgaaatgtcagaac
gagcagctgcaaacagcagtcacccagcaggcttctcagattcagcagcacaaggatcag
tacaacctcctcaaagttcagctcgggaaagacaatcaccatcaaggttctcacagtgac
ggggctcaggtaaatggcattcagccagaggaaatcagtcggctgagggaagagatagaa
gaattaagaagtcatcaggtgctcttacagagccagctagctgaaaaggacactgtgatt
gaaaatttgagatcttcacaagtgtctggcatgagtgaacaggctttagcaacgtgttca
cccagagatgccgagcaagttgcagagttaaaacaggaattgtcagcattaaagtcccag
ttatgttcacagtctctggagatcactagactccagacagagaaccgtgagctgcaacag
agagcagagaccttggcaaagtcagttcctgtagaaggagagagtgagcttgtgacagcc
gcaaaaactacggatgtagagggaaggctgtctgccctgctgcaggagaccaaagagtta
aagaatgagattaaagcattgtctgaggagaggacctccattcaaaagcagctggactcc
tccaacagcaccatcgccatcctacaaacggagaaagacaagctatacttggaagttacg
gattctaagaaagaacaagatgatcttttggtgctgttggcagatcaagatcagaaaatc
ctgtcactgaagagtaaactcaaggatcttggtcatccagttgaagaagaagatgaatct
ggagaccaagaagatgatgatgatgaacttgacgatggtgacagggaccaggatatctag

DBGET integrated database retrieval system