KEGG   Rattus norvegicus (rat): 56064Help
Entry
56064             CDS       T01003                                 

Gene name
Nptn, Sdfr1
Definition
(RefSeq) neuroplastin
  KO
K22653  neuroplastin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:rno04515]
    56064 (Nptn)
Cell adhesion molecules [BR:rno04515]
 Immunoglobulin superfamily
  Neuroplastin
   56064 (Nptn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_4 Ig_6 Ig_5 C2-set
Motif
Other DBs
NCBI-GeneID: 56064
NCBI-ProteinID: NP_062253
RGD: 620296
Ensembl: ENSRNOG00000009029
UniProt: P97546
Structure
PDB: 

Position
8q24
AA seq 393 aa AA seqDB search
MSGSSLPGALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTP
EIQWWYAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASN
DPKRNDLRQNPSITWIRAQATISVLQKPRIVTSEEVIIRDSLLPVTLQCNLTSSSHTLMY
SYWTKNGVELTATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDIT
GHKRSENKNEGQDAMMYCKSVGYPHPEWMWRKKENGVFEEISNSSGRFFIINKENYTELN
IVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYE
KRKRPDEVPDAGPMKTNSTNNHKDKNLRQRNTN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggctcgtcgctccccggcgccctggccctctcgctcttgctggtctctggctcg
ctcctcccagggccaggcgctgctcagaacgctgggtttgtcaagtcgcccatgtcagaa
actaagctcacaggggacgcctttgagctgtactgtgatgtggtcgggagtcccacgcca
gagatccagtggtggtacgcagaagtcaaccgggcagagtctttcagacagctgtgggac
ggtgctcggaagcgccgtgtcaccgtaaacaccgcctacgggtcaaacggcgtgagtgtg
ctgagaataacccggctcaccttggaggactctgggacttacgagtgcagggcaagcaac
gaccccaaacggaatgacttgaggcaaaacccttccataacatggattcgagcccaggcc
accataagcgtccttcagaaaccaagaattgtcaccagcgaagaggtcattattcgagac
agcctccttcctgtcaccctgcagtgtaacctcacttccagctctcacacccttatgtac
agctactggacaaagaatggggtagaactcactgccacccgtaagaatgccagcaacatg
gaatacaggatcaataagccaagagctgaggattcaggcgaataccactgtgtatatcat
tttgtcagcgctcctaaagcaaatgccaccattgaagtgaaagctgctcctgacatcact
ggccataaacgcagtgaaaacaaaaatgaagggcaggatgctatgatgtattgcaagtct
gttggctacccccacccggaatggatgtggcgcaagaaggagaatggtgtgtttgaggag
atttccaatagctctggtcgcttcttcatcatcaacaaggagaattacactgaattgaat
attgtgaatctccaaatcacagaagatcctggagagtatgaatgtaatgccaccaactcc
attggctctgcctccgtttccacagtcctcagggtacggagccaccttgccccactttgg
cctttcttgggaattctggctgaaatcatcatccttgtggtgatcattgttgtgtatgag
aagaggaagaggccagatgaggttcctgatgccgggccaatgaaaaccaactctaccaac
aatcacaaagataaaaacttgcgccagagaaacacaaattaa

DBGET integrated database retrieval system