KEGG   Rattus norvegicus (rat): 56083Help
Entry
56083             CDS       T01003                                 

Gene name
Tgm2, TgaseII
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    56083 (Tgm2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     56083 (Tgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 56083
NCBI-ProteinID: NP_062259
RGD: 621081
Ensembl: ENSRNOG00000012956
UniProt: Q6P6R6
Position
3q42
AA seq 686 aa AA seqDB search
MAEELNLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYFEGRGYEASVDRLTFG
AVTGPDPSEEAGTKARFSLSDDVEEGSWSASVLDQQDNVLSLQLCTPANAPVGQYRLSLE
TSTGYQGSSFMLGHFILLFNAWCPADDVYLDSEAERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDACLMLLDVNPKFLKDRSRDCSRRSSPIYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEYGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDASFVFAEVNADVVDWIRQSDGSVLKSINNSL
VVGQKISTKSVGRDDREDITYTYKYPEGSPEEREVFTRANHLNKLAEKEETGVAMRIRVG
DGMSLGNDFDVFAHIGNDTSESRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLVEPAANSYLLAERDLYLENPEIKIRILGEPKQNR
KLVAEVSLKNPLSDSLYDCVFTVEGAGLTKEQKSVEVSDPVPAGDAVKVRVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNIIIGPA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctgaacctggagaggtgcgatttggagatacaggccaatggccgtgat
caccacacggccgacctgtgccaagagaaactggtgctgcggcgaggccagcgcttccgg
ctgacactgtacttcgagggccgtggctatgaggccagcgtggacagacttacatttggt
gccgtgaccggcccagatcccagtgaagaggcagggaccaaggcccgcttctcactgtct
gacgatgtggaggagggatcctggtcagcctctgtgctggaccaacaggacaatgtcctc
tcgctgcagctctgcaccccagccaatgctcctgttggccagtaccgcctcagcctggag
acttctactggctaccaaggctccagcttcatgctgggtcacttcatcctgctcttcaat
gcctggtgcccagcggatgacgtgtacctagattcagaggcggagcgccgggaatacgtc
ctcacacagcagggcttcatctaccagggctctgtcaagttcatcaagagtgtgccttgg
aactttgggcagtttgaggatgggatcctggatgcctgcctgatgcttttggatgtgaac
cccaagttcctgaaggaccgtagccgggactgctcacgacgcagcagtcccatctatgtg
ggccgcgtggtgagcggcatggtcaactgcaatgatgaccagggtgtgcttctgggtcgc
tgggacaacaattatggggacggtatcagtcccatggcctggattggcagcgtggacatt
ctgcggcgctggaaggaacacggctgtcagcaagtgaagtatggccagtgctgggtgttt
gcggcggtagcctgcacagtgctgcggtgccttggcatccctaccagagtggtgaccaac
tacaactccgcccacgaccagaacagcaacctgctcatcgagtacttccgaaacgagtac
ggggagctggagagcaacaagagcgagatgatctggaatttccactgctgggtggagtcc
tggatgaccaggccagacctacagccaggctatgaggggtggcaggccattgaccccaca
ccgcaggagaagagcgaaggaacatactgttgtggcccagtctcagtgcgggccatcaag
gagggtgacctgagcaccaagtatgatgcgtccttcgtgtttgccgaggtcaacgctgat
gtggtggactggatccggcagtcagatgggtctgtgctcaaatccatcaacaattccctg
gtcgtggggcagaagatcagcactaagagcgtgggccgtgatgaccgggaggacatcacc
tatacctacaagtacccagaggggtccccagaggagagggaagtcttcaccagagccaac
cacctgaacaaactggcagagaaagaggagacaggggtggccatgcggatccgagtgggg
gatggtatgagcttgggcaatgactttgacgtgtttgcccacatcggcaacgacacctcg
gagagccgtgagtgccgcctcctgctctgtgcccgcactgtcagctacaacggcgtgctg
gggcccgagtgtggcactgaggacatcaacctgaccctggatccctactctgagaacagc
atcccccttcgcatcctctacgagaagtacagcggttgcctgaccgagtcaaacctcatc
aaggtgcggggtctcctcgtcgagccagccgctaacagctacctgctggctgagagagat
ctctacctggagaatcctgaaatcaagatccggatcctgggggagcccaagcagaaccgc
aaactggtggctgaggtgtccctgaagaacccactttctgattccctgtatgactgtgtc
ttcactgtggagggggctggcctgaccaaggaacagaagtctgtggaggtctcagaccct
gtgccagcaggagatgcggtcaaggtgcgggttgacctgttcccgactgatattggcctc
cacaagttggtggtgaacttccagtgtgacaagctgaagtcggtcaagggttaccggaat
atcatcatcggcccggcctaa

DBGET integrated database retrieval system