KEGG   Rattus norvegicus (rat): 56083
Entry
56083             CDS       T01003                                 

Gene name
Tgm2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    56083 (Tgm2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     56083 (Tgm2)
SSDB
Motif
Pfam: Transglut_C Transglut_N Transglut_core MG2
Other DBs
NCBI-GeneID: 56083
NCBI-ProteinID: NP_062259
RGD: 621081
Ensembl: ENSRNOG00000012956
UniProt: Q9WVJ6
Position
3
AA seq 686 aa
MAEELNLERCDLEIQANGRDHHTADLCQQKLVLRRGQRFRLTLYFEGRGYEASVDRLTFG
AVTGPDPSEEAGTKARFSLSDDVEEGSWSASVLDQQDNVLSLQLCTPANAPVGQYRLSLE
TSTGYQGSSFMLGHFILLFNAWCPADDVYLDSEAERREYVLTQQGFIYQGSVKFIKSVPW
NFGQFEDGILDACLMLLDVNPKFLKDRSRDCSRRSSPIYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEYGELESNKSEMIWNFHCWVESWMTRPDLQPGYEGWQAIDPT
PQEKSEGTYCCGPVSVRAIKEGDLSTKYDASFVFAEVNADVVDWIRQSDGSVLKSINNSL
VVGQKISTKSVGRDDREDITYTYKYPEGSPEEREVFTRANHLNKLAEKEETGVAMRIRVG
DGMSLGNDFDVFAHIGNDTSESRECRLLLCARTVSYNGVLGPECGTEDINLTLDPYSENS
IPLRILYEKYSGCLTESNLIKVRGLLVEPAANSYLLAERDLYLENPEIKIRILGEPKQNR
KLVAEVSLKNPLSDSLYDCVFTVEGAGLTKEQKSVEVSDPVPAGDAVKVRVDLFPTDIGL
HKLVVNFQCDKLKSVKGYRNIIIGPA
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggccgaggagctgaacctggagaggtgcgacttggagatacaggccaatggccgtgat
caccacacggccgacctgtgccaacagaaactggtgctgcggcgaggccagcgcttccgg
ctgacactgtacttcgagggccgtggctatgaggccagcgtggacagacttacatttggt
gccgtgaccggcccagatcccagtgaagaggcagggaccaaggcccgattctcactgtct
gacgatgtggaggagggatcctggtcagcctctgtgctggaccaacaggacaatgtcctc
tcgctgcagctctgcaccccagccaatgctcctgttggccagtaccgcctcagcctggag
acttctactggctaccaaggctccagcttcatgctgggtcacttcatcctgctcttcaat
gcctggtgcccagcggatgacgtgtacctagattcagaggcggagcgccgggaatacgtc
ctcacacagcagggcttcatctaccagggctctgtcaagttcatcaagagtgtgccttgg
aactttgggcagtttgaggatgggatcctggatgcctgcctgatgctcttggatgtgaac
cccaagttcctgaaggaccgtagccgggactgctcacgacgcagcagtcccatctatgtg
ggccgcgtggtgagcggcatggtcaactgcaatgatgaccagggtgtgcttctgggtcgc
tgggacaacaattatggggacggtatcagtcccatggcctggatcggcagcgtggacatt
ctgcggcgctggaaggaacacggctgtcagcaagtgaagtatggccagtgctgggtgttt
gcggcggtagcctgcacagtgctgcggtgccttggcatccctaccagagtggtgaccaac
tacaactccgcccacgaccagaacagcaacctgctcatcgagtacttccgaaacgagtac
ggggagctggagagcaacaagagcgagatgatctggaatttccactgctgggtggagtcc
tggatgaccaggccagacctacagccaggctatgaggggtggcaggccattgaccccaca
ccgcaggagaagagcgaaggaacatactgttgtggcccagtctcagtgcgggccatcaag
gagggtgacctgagcaccaagtatgatgcgtccttcgtgtttgccgaggtcaacgctgat
gtggtggactggatccggcagtcagatgggtctgtgctcaaatccatcaacaattccctg
gtcgtggggcagaagatcagcactaagagcgtgggccgtgatgaccgggaggacatcacc
tatacctacaagtacccagaggggtccccagaggagagggaagtcttcaccagagccaac
cacctgaacaaactggcagagaaagaggagacaggggtggccatgcggatccgagtgggg
gatggtatgagcttgggcaatgactttgacgtgtttgcccacatcggcaacgacacctcg
gagagccgtgagtgccgcctcctgctctgtgcccgcactgtcagctacaacggcgtgctg
gggcccgagtgtggcactgaggacatcaacctgaccctggatccctactctgagaacagc
atcccccttcgcatcctctacgagaagtacagcggttgcctgaccgagtcaaacctcatc
aaggtgcggggtctcctcgtcgagccagctgctaacagctacctgctggctgagagagat
ctctacctggagaatcctgaaatcaagatccggatcctgggggagcccaagcagaaccgc
aaactggtggctgaggtgtccctgaagaacccactttctgattccctgtatgactgtgtc
ttcactgtggagggggctggcctgaccaaggaacagaagtctgtggaggtctcagaccct
gtgccagcaggagatgcggtcaaggtgcgggttgacctgttcccgactgatattggcctc
cacaagttggtggtgaacttccagtgtgacaagctgaagtcggtcaagggttaccggaat
atcatcatcggcccggcctaa

DBGET integrated database retrieval system