KEGG   Rattus norvegicus (rat): 56084
Entry
56084             CDS       T01003                                 

Gene name
Hgs
Definition
(RefSeq) hepatocyte growth factor-regulated tyrosine kinase substrate
  KO
K12182  hepatocyte growth factor-regulated tyrosine kinase substrate
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56084 (Hgs)
   04145 Phagosome
    56084 (Hgs)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    56084 (Hgs)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    56084 (Hgs)
SSDB
Motif
Pfam: VHS Hrs_helical FYVE FYVE_2 UIM
Other DBs
NCBI-GeneID: 56084
NCBI-ProteinID: NP_062260
RGD: 69225
Ensembl: ENSRNOG00000036696
UniProt: Q9JJ50
Position
10
AA seq 771 aa
MGRGSGTFERLLDKATSQLLLETDWESILQICDLIRQGDTQAKYAVNSIKKKVNDKNPHV
ALYALEVMESVVKNCGQTVHDEVANKQTMEELKELLKRQVEVNVRNKILYLIQAWAHAFR
NEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVVTRKH
HCRACGQIFCGKCSSKYSTIPKFGIEKEVRVCEPCYEQLNKKAEGKAASTTELPPEYLTS
PLSQQSQLPPKRDETALQEEEELQLALALSQSEAEEKERMRQKSTYTAHPKSEPAPLASS
APPAGSLYSSPVNSSAPLAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQ
PGEGHTAPNSMVEAPLPETDSQPITSCSGPFSEQYQNGESEESHEQFLKALQNAVSTFVN
RMKSNHMRGRSITNDSAVLSLFQSINSTHPQLLELLNRLDERRLYYEGLQDKLAQIRDAR
GALSALREEHREKLRRAAEEAERQRQIQLAQKLEIMRQKKQEYLEVQRQLAIQRLQEQEK
ERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPTAGGVLYQPSGPTSFPGTFSPAGSVEG
SPMHGVYMSQPAPATGPYPSMPGTTADPSMVSAYMYPAGAPGAQAAPQAQAGPTTNPAYS
SYQPTPTPGYQAPQSLPAISQPPQTSNIGYMGSQPMSMGYQPYNMQNLMTTLPGQDASLP
AQQPYITGQQPMYQQMAPSTGPPQQQPPVAQPPPTQGPPAQGNETQLISFD
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggggcgaggcagcggcaccttcgagcgtctcctagacaaagccaccagccagcttcta
ttggagacagactgggagtccattctacagatctgcgacctgatccgtcagggggacaca
caagcaaaatatgctgtaaactccatcaagaagaaggtcaatgataagaacccacatgtg
gctttgtatgctctggaggtgatggagtctgtggtaaagaactgtggccagacagtccat
gatgaagtggccaacaaacagaccatggaagaactgaaggagctgctgaagaggcaagtg
gaagttaatgttcggaacaagatcttgtacctgatccaggcctgggcacatgcgttccgg
aatgaacccaagtacaaggtggtccaggacacataccagatcatgaaggtagaaggacat
gtcttccctgagtttaaggagagcgacgccatgtttgctgctgaaagagcccctgactgg
gtggatgctgaggagtgccatcggtgcagagtacagtttggagtggtgacccgcaagcat
cactgccgagcgtgtgggcagatcttttgtggcaagtgttcctccaagtactccaccatc
cccaagttcggcattgagaaggaagtgcgcgtgtgtgagccctgctatgagcagctgaac
aagaaggcagaagggaaagctgcctctaccactgagctgcccccagagtacctgaccagc
cccctgtcacagcagtctcagctgcccccaaagcgggatgagacagcactgcaagaagag
gaggagctacagctggcgctggccctatcacagtcagaggctgaggagaaggaaaggatg
agacagaagtcaacatacacagcgcatccaaagtcagagcctgcgcccttggcttcctct
gcacccccagctggtagcctgtactcctcgcctgtgaactcatcagcacctctggctgag
gacatcgaccctgagcttgcaagatacctcaaccggaactactgggagaagaaacaggaa
gaagctcggaagagccccacaccatctgcacctgtgcccctgaccgagccagctgcccag
cccggagaaggacatacagcccccaacagcatggtagaggcccctcttccagagacagac
tctcagcccataacttcctgcagtggcccctttagtgagcagtaccagaacggggagtcg
gaggagagccacgagcagttcctcaaggccctgcagaatgcagtcagcacttttgtcaac
cgcatgaagagcaaccacatgaggggccgcagtatcaccaatgactcggctgtgctgtcc
ctcttccagtccatcaatagcacacacccacagctgctcgagctgctcaaccggctggat
gagcgcaggctgtactacgaggggcttcaggacaagctggcacagatacgtgatgcccga
ggggccctgagtgccctgcgtgaagagcacagggagaagctgcgccgggcagctgaggag
gcggagcgtcaacgtcagatccagctggcacagaagctggagatcatgagacaaaagaag
caggagtatctggaggtgcagagacagctagctatccagcgtctgcaggaacaggagaag
gaacggcagatgcgcctggagcaacagaagcagactgtccagatgcgtgcccagatgcct
gccttccccttgccttatgcccagctccaggctatgcccacagctgggggtgtactctac
cagccctcaggcccaaccagctttcctggcacctttagcccagcaggctcagtagagggc
tctccgatgcatggtgtgtatatgagccagccagccccagccactggcccctaccccagc
atgcctggcaccacagcagatcccagcatggtcagcgcctacatgtacccagcaggtgcc
cctggggcacaggcagcccctcaggcccaggccgggcccaccaccaaccctgcctactcc
tcgtaccagcctactccaaccccaggctaccaggccccacagagcctcccagccatctcc
cagcctccacagaccagcaacattggctacatggggagccagccaatgtccatgggctac
cagccatacaacatgcagaatctcatgaccacccttccaggccaggatgcgtctctgcca
gcccagcagccctacatcacagggcagcagcccatgtaccagcagatggcacccagcact
ggccctccccagcagcagccccctgtggcccaaccgccacctacacagggaccgccagca
cagggcaatgagacccagctcatctccttcgactga

DBGET integrated database retrieval system