KEGG   Rattus norvegicus (rat): 56759
Entry
56759             CDS       T01003                                 

Gene name
Rnase4, Rab1
Definition
(RefSeq) ribonuclease A family member 4
  KO
K16632  ribonuclease 4 [EC:3.1.27.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    56759 (Rnase4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     56759 (Rnase4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA degradation factors
   Other degradation factors
    RNases
     56759 (Rnase4)
SSDB
Motif
Pfam: RnaseA
Other DBs
NCBI-GeneID: 56759
NCBI-ProteinID: NP_064467
RGD: 61823
Ensembl: ENSRNOG00000025625
UniProt: O55004 W0UVG1
Position
15p14
AA seq 147 aa
MDIQRTQSLLLLLLLTLLGLGLVQPSYGQDRMYQRFLRQHVDPEGTGGSDNYCNVMMQRR
RMTSTQCKRFNTFIHEDIWNIRSICDTANIPCKNGNMNCHEGIVRVTDCRETGSSVPHNC
RYRARASTRRVVIACEGTPEVPVHFDR
NT seq 444 nt   +upstreamnt  +downstreamnt
atggacatacagaggacccaatccttgcttctgctcttgttgctgaccctgctggggtta
gggcttgtacagccctcctatggccaagatagaatgtaccaacggttccttagacagcat
gtggaccctgaggggacaggcggcagcgacaactactgcaacgtgatgatgcagagacgg
aggatgacttctacccagtgcaaacgcttcaacaccttcatccacgaagacatctggaac
attcgcagcatctgtgatactgccaatatcccatgcaagaatggcaatatgaactgtcac
gaaggcatagtgagggtcactgactgcagagagacagggagctctgtgccccacaactgt
aggtacagggcgagagccagcactaggcgagttgtcattgcctgtgagggtaccccagag
gtcccagtgcactttgacagatag

DBGET integrated database retrieval system