KEGG   Rattus norvegicus (rat): 56763Help
Entry
56763             CDS       T01003                                 

Gene name
Srek1, Sfrs12, Srrp86, Srsf12
Definition
(RefSeq) splicing regulatory glutamic acid and lysine rich protein 1
  KO
K13165  splicing factor, arginine/serine-rich 12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    56763 (Srek1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR proteins
    56763 (Srek1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 56763
NCBI-ProteinID: NP_064477
RGD: 621696
Ensembl: ENSRNOG00000032735
UniProt: Q9JKL7
Position
2q12
AA seq 494 aa AA seqDB search
MTSLVPGAGLLPIPTSSPLTAVSSLGVSLSSLGAIPAAALDPNITALGEIPQPPLMGNVD
PSKIDEIRRTVYVGNLNSQTTTADQLLEFFKQVGEVKFVRMAGDETQPTRFAFVEFADQN
SVPRALAFNGVMFGDRPLKINHSNNAIVKPPEMTPQAAAKELEEVMKRVREAQSFISAAI
EPESGKSNERKGGRSRSHTRSKSRSSSKSHSRRKRSQSKHRSRSHNRSRSRQKDRARSKS
PHKKRSKSRERRKSRSRSRSRDKRKDTREKVKERVKEREREKEKEREKEREKDKERGKNK
DKDREKEKDHEKERDKEKEKEQDKDKEREKDRSKEADEKRKKEKKSRTPPRSYNSSRRSR
SASRERRRRRSRSSSRSPRTSKTIKRKSSRSPSPRGRNKKEKKREKERDHISDRRERERS
TSTKKSSSDRDGKEKVEKTNTPVKEKEHSKEADSTVSTDADEKDTARTEEESKAQHNGNC
QPHEERLCSTADAV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcctggtgcctggtgcagggctgcttcccataccaacctccagtccactgacg
gcagtgagtagtcttggcgtttcacttagcagtttgggagccataccggcagcagcactg
gacccaaacatcacagcacttggagagataccacagccaccacttatgggaaatgtggat
ccttctaaaattgacgagattaggagaacagtttatgttggaaatttgaattcacagaca
acgacagctgatcaactacttgaattttttaaacaagttggagaagtgaagtttgttcgg
atggcaggtgatgagactcagccaactcggtttgcttttgtggaatttgcagaccaaaat
tctgtaccaagggcccttgcttttaatggagttatgtttggagacaggccgctgaaaata
aatcactccaacaatgcaatagtaaaacctcctgagatgacacctcaggctgcagctaag
gagttagaagaagtaatgaagcgagtgcgggaggctcagtcatttatctcagcagccatt
gaaccagagtctggaaagagcaatgaaaggaaaggcggtcgatctcgttcccacactcgc
tcaaagtccaggtctagctcaaagtcccattctagaaggaagagatcgcagtcaaagcac
aggagtagatcccataacaggtcacgttcaagacagaaagatagagctagatccaagagc
ccacataagaaacgctctaagtctagggagaggcggaagtcaaggagccggtcgcggtca
cgggacaagagaaaagatacccgggaaaaggtgaaggaaagagtgaaggagagagaaagg
gaaaaggaaaaggaaagggaaaaggagcgtgaaaaagacaaggaacggggtaaaaacaaa
gataaagaccgtgagaaggaaaaggaccatgaaaaggagcgagacaaagaaaaggagaag
gaacaagataaagacaaggaacgggaaaaagacagatccaaagaggcagatgaaaaacgg
aagaaggagaagaagtctagaacaccgccccgaagctacaattcctcaagacgatcccgt
agtgccagcagggaaaggcggaggaggagaagcaggagttcttctagatcgccaagaaca
tcaaagaccataaaaagaaagtcttctaggtctccgtctcccaggggccggaataagaaa
gagaaaaagagagagaaagaacgggaccacatcagtgacaggagagaaagagagcgttcc
acctccacaaaaaagagttctagtgaccgagacgggaaggagaaggtggagaagactaac
acaccagttaaggagaaggaacacagtaaagaggcagattcaactgtgagcaccgatgcg
gatgagaaggacactgccaggactgaggaggaaagtaaagcacagcacaatgggaattgc
cagccccacgaagagcgcctgtgcagcacggccgacgctgtgtag

DBGET integrated database retrieval system