KEGG   Rattus norvegicus (rat): 56768
Entry
56768             CDS       T01003                                 

Gene name
Pclo, aczonin
Definition
(RefSeq) piccolo (presynaptic cytomatrix protein)
  KO
K16882  protein piccolo
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    56768 (Pclo)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    56768 (Pclo)
SSDB
Motif
Pfam: zf-piccolo C2 PDZ FYVE_2
Other DBs
NCBI-GeneID: 56768
NCBI-ProteinID: NP_064483
RGD: 69406
UniProt: Q9JKS6
Structure
PDB: 
1RH8

Position
4q12
AA seq 5085 aa
MGNEASLEGEGLPEGLAAAAGAGGSGSALHPGIPAGMEADLSQLSEEERRQIAAVMSRAQ
GLPKGSVPPAAAESPSMHRKQELDSSQAPQQPGKPPDPGRPTQPGLSKSRTTDTFRSEQK
LPGRSPSTISLKESKSRTDFKEEYKSSMMPGFFSDVNPLSAVSSVVNKFNPFDLISDSEA
SQEETTKKQKVVQKEQGKSEGMAKPPLQQPSPKPIPKQQGQVKEVIQQDSSPKSVSSQQA
EKVKPQAPGTGKPSQQSPAQTPAQQASPGKPVAQQPGSAKATVQQPGPAKSPAQPAGTGK
SPAQPPAKTPGQQAGLEKTSSSQQPGPKSLAQTPGHGKFPLGPVKSPAQQPGTAKHPAQQ
PGPQTAAKVPGPTKTPAQQSGPGKTPAQQPGPTKPSPQQPIPAKPQPQQPVATKTQPQQS
APAKPQPQQPAPAKPQPQQPTPAKPQPQPPTPAKPQPQPPTATKPQPQPPTATKPHHQQP
GLAKPSAQQPTKSISQTVTGRPLQPPPTSAAQTPAQGLSKTICPLCNTTELLLHIPEKAN
FNTCTECQSTVCSLCGFNPNPHLTEIKEWLCLNCQMQRALGGDLAAAIPSSPQPTPKAAT
APTATASKSPVPSQQASPKKEPPSKQDSPKALESKKPPEPKKPPEPKKPPEPKKPPPLVK
QPTLHGPTPATAPQLPVAEALPEPAPPKEPSGPLPEQAKAPVGDVEPKQPKMTETRADIQ
SSSTTKPDILSSQVQSQAQVKTASPLKTDSAKPSQSFPPTGEKTTPLDSKAMPRPASDSK
IISQPGPGSESKDPKHIDPIQKKDEPKKAQPKGSPKPETKPVPKGSPTPSGTRPTAGQAA
PPSQQPPKPQEQSRRFSLNLGGITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTA
GQQGPHPQTGPAAPSKQAPTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLE
SKPEQAPTAKKTEKDKKPPPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLG
SQEPPNFNTCTECKNQVCNLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMGKMPPAP
SGPKASPMPAPAEPSSQKTPTGTQVKGKKKEAEGKTEAEKPVPEKETASIEKTPPMVTTD
QKLEESEGKKSKVSALPEKKPSEEEKAISADKKERKPPAEEKPPLEEKKPIPVDKKLPPE
AKPLSSEGEEKHEILKAHVQIPEEEPTGKVAAKAGEEEQQPDSRPEALPGATPLTLPKAG
EKERAVAQPQAEGSSKDGQGERSKEKTEKEEDKSDTSSSQQPKSPQGLSDTGYSSDGISG
SLGEIPSLIPSDEKDLLKGLKKDSFSQESSPSSPSDLAKLESTVLSILEAQASTLVGEKA
EKKTQPQKISPEKPQDQQKTQTASETLDITISEEEIKESQEKKVSPKKDSEQGFPSRKEH
KEKPELVDDLSPRRASYDSVEDSSESENSPVVRRKRRTSIGSSSSDEYKQEDSQGSGEEE
DFIRKQIIEMSADEDASGSEDEEFIRSQLKEISGVGESQKREEAKGKGKGVAGKHRRLTR
KSSTSFDDDAGRRHSWHDEDDETFDESPELKFRETKSQESEELVVAGGGGLRRFKTIELN
STIADKYSSESSQKKTILYFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTS
VSSLDEDSDSSPSHKKGESKQQRKARHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQR
ELEQQQRKSSSKKSKKDKDELRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHR
SSCSEYSPSIESDPEGFEISPEKIIEVQKVYKLPAAVSLYSPTDEQSVMQKEGVQKALKS
AEEMYEEMMQKPHKYKAFPAANERDEVFEKEPLYGGMLIEDYIYESLVEDTYNGSVDGSL
LTRQEEQNGFMQQRGREQKVRLQEQIYDDPMQKISDLQKEFYELESLHSVVPQEDIVSSS
YIIPESHEIVDLGSMVMSTSEEKKLLDADSAYEELMRRQQVQVTDGSSPVQTTIGDDMAE
STLDFDRVQDASLTSSILSGASLTDSTSSATLSIPDVKITQQFSAEELEDEYVTDYTREI
QDIIAHESLILTYSEPSESATSVPPSDTPSLTSSISSVCTTDSSSPVTTLDSLTTVYTEP
ADVMTKFKDSEEISSTYFPGSIIDYPEDISVSLDRTIMPESRTNEDRIVLSFSGMAPSVV
ESVGTKPERPQADTISTDLPISEKDLIKGKKETGDGIILEVLDAYKDKREESEAELTKIS
LPEPGLAQAPSSVTAPQIKEQHVSPHSVSGKISGQEKPTYRLPSGSLPVSTHPSKSRPFF
RSSSLDISAQPPPPPPPPPPSPSTSSPPPTPPLPPATSPKPPTYPKKKLAVAATVTSTTI
VTTHVDALTMVEAAAARRSNGLPATKMCAIAPPPVPPKPSQIPTGLVFTHRPEAIKPPIA
PKPAVPQIPVTTQKPTDTCPKPTGLSLTSTMSLNLVTSADYNVPSPTSPLSPHSNKSSPR
YSKSLMDTYVVITLPSEPGTPTDSSAAQAITSWPLGSPPKDLVSLETVFSVVPPMTSTEI
PSASQPTLYTSGALGTFSVTPAVTASLFQTVPTSLTQFLPAEASKPEVSAVSSAVPSVAP
RSVSIPIPPEPLALDRHQYKENGKLPLIGDAIDLRTIPKSEVKVTEKCMDLSASAMDVKR
QTTANEVYRRQISAVQPSIINLSAASSLGTPVTMDSKTVAVVTCTDTTIYTTGTESQVGI
EHAVTSPLQLTTSKHTELPYRKPSSQAFPTIRDEAPINLSLGPSAQAVTLAVTKPVTVPP
VGVTNGWTDSTLSQGVADGEVVDLSTSKSHRTVVTMDESTSNVVTKIIEDDEKPVDLTAG
RRAVCCDMVYTLPFGRSCTAQQPATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMS
DTNLPEAGHFFYKSKNAFDYSGGTGAAVDLTSGRVSTGEVMDYSSKTTGPYPETRQVISG
VGISTPQYSTARLTPPPGPQYGVGSVLRSSNGVVYSSVATPIPSTFAITTQPGSIFSTTV
RDLSGIPTTDAMTSLSALHQSQPMPRSYFITTGASETDIAVTGIDINASLQTITMETLPA
ETMDSVPTLTTASEVFSEVVGEESTLLIVPDEDKQQQQLDLERELLELEKIKQQRFAEEL
EWERQEIQRFREQEKIMVQKKLEELQSMKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQ
IQQLQQQLHQQLEEQKLRQIYQYNYDPSGTSSPQTTTEQAILEGQYAATEGSQFWATEDA
TTTASTVVAIEIPQSQGWYTVQSDGVTQYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSS
GAKVRGQYDEMGESVADDPRNLKKIVDSGVQTDDEETADRSYASRRRRTKKSVDTSVQTD
DEDQDEWDMPSRSRRKARTGKYGDSTAEGDKTKPLSKVSSVAVQTVAEISVQTEPVGTIR
TPSIRARVDAKVEIIKHISAPEKTYKGGSLGCQTETDSDTQSPPYLGATSPPKDKKRPTP
LEIGYSSSHLRADPTVQLAPSPPKSPKVLYSPISPLSPGNALEPAFVPYEKPLPDDISPQ
KVLHPDMAKVPPASPKTAKMMQRSMSDPKPLSPTADESSRAPFQYSEGFTTKGSQTMTAS
GTQKKVKRTLPNPPPEEVSTGTQSTYSTMGTASRRRMCRTNTMARAKILQDIDRELDLVE
RESAKLRKKQAELDEEEKEIDAKLRYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYM
SDSEVSSTRPSRVESQHGVERPRTAPQTEFSQFIPPQTQTEAQLVPPTSPYTQYQYSSPA
LPTQAPTPYTQQSHFQQQTLYHQQVSPYQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPS
QMMVIQQKPRQTTLYLEPKITSNYEVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIG
LEERSSMAGSPISSISADSFYADIDHHTSRNYVLIDDIGDITKGTAALSTVFSLHEKDLS
KTDRLLRTTETRRSQEVTDFLAPLQTSSRLHSYVKADEDPMEDPYELKLLKHQIKQEFRR
GTESLDHLAGLSHYYHADTSYRHFPKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKS
LIDPKMSKFSPIQESRDLEPDYPTYMSSGTSSIGGISSRARLLQDDITFGLRKNITDQQK
FMGSSLGSGLGTLGNTIRSALQDEADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSL
RLKAQEAEALDVSFGHSSSSARTKPTSLPISQSRGRIPIVAQSSEEESPLSPVGQPMGMA
RAAAGPLPPISADTRDQFGSSHSLPEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEA
YHLRREETDWFDKPRESRLENGHGLDRKLPERLVHSRPLSQHQEQILQMNGKTIHYIFPH
ARVKITRDFKDHTGSGNGLGIRIVGGKEIPGHSGEIGAYIAKILPGESAEHTGPLMEGMQ
VLEWNGVPLTSKTYEEVQSIINQQSGEAEICVRLDLNMLSDSENPQHLELHEPPKVDKAK
SPGVDPKQLAAELQKVSLQQSPLVMSSVVEKGSHAHSGPTSAGSSSVPSPGQPGSPSVSK
KKHSSTKPTDGPKAASHPITGEIQLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVY
LLPGRGQVMVVQNASAEYKRRTKYVQKSLNPEWNQTVIYKSISMEQLMKKTLEVTVWDYD
RFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTESIDHGKSHSSQNSQQSPKPSVIKSR
SHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVAQTHLEDAGVA
IAAAEAAVQQLRIQPTKPTNHRPAESSVSTGSSGSSVGSGYSVDSEGSSCVAGEPNLLPI
PRIGKMGQNGQDPVKQPGMGATDTEGKTQVMGEIKLALKKEMKTDGEQLIVEILQCRNIT
YKFKSPDHLPDLYVKLYVINISTQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQI
LLFSNGGKFMKKTLIGEACIWLDKVDLRKRIVNWHKLLVSPTQTH
NT seq 15258 nt   +upstreamnt  +downstreamnt
atgggcaacgaggcgagcttggaaggggaagggctccccgaagggctggcggcggccgca
ggggctggcggttcggggagcgccctgcaccccgggatcccagccggcatggaggcggac
ctgagccagctgagcgaggaggagaggagacagatcgctgctgtcatgtcaagggcgcag
gggctgcccaagggaagcgttcccccggccgctgcggagtcgccctccatgcacaggaaa
caagagttggatagtagtcaggctccacaacaaccaggaaagccaccggaccctgggcgt
cccactcagcctggtctcagtaaaagcagaactacggacacgtttaggtcagagcagaag
ctgcctggaaggagtccgtccacgatcagcttgaaagaatcgaagtccagaactgatttt
aaggaagaatacaagtctagtatgatgcctggtttcttctcagatgttaacccgttaagt
gctgtctcctctgttgtaaataaattcaacccttttgatttgatatcagactctgaggca
tcccaggaggaaactacaaagaaacaaaaagttgtccagaaggagcaagggaaatcggaa
ggaatggcaaaacctcccttacagcaaccatcacctaagccgatccctaaacagcaagga
caagtgaaggaagtgatccagcaagacagctctcccaagtcagtatcttcccagcaagca
gaaaaagtaaaaccacaagcccctggcacaggaaagccttcccaacagagtccagcccaa
acaccagctcagcaagctagtcctggaaaacctgtagcccaacagcctggatctgcaaag
gccacagtccagcagccagggccagcaaagtccccagctcaaccagcagggacagggaaa
tccccagcccaacctccagccaagaccccaggtcagcaggctggattagagaagacctca
tcatcgcagcagcctgggccaaagtctctagcccagactcctggtcatgggaagtttcca
ctggggccagtaaagtctccagcccagcagccagggacagcaaaacacccagctcaacag
cctggcccacagactgcagctaaggtacctgggcctacaaaaactccagctcagcaatct
ggacctggaaagacaccagctcaacagccaggtccaacaaagccttcacctcagcaaccc
attccagcaaagccccagcctcagcaacctgttgccacaaaaactcagcctcaacagtct
gccccagcaaaaccccagcctcagcagccagccccagcaaagccccagcctcagcagcca
actccagcaaagcctcagcctcaaccgcccaccccagcaaagccccagcctcaaccgccc
acagcaacaaagccccagcctcaaccgcccacagcaacaaagccccaccatcaacagcca
ggcctggcaaaaccttcagctcagcaacctacaaaatcgataagccaaacggtaactgga
cgacctctgcaaccaccaccaacttctgcagcacagactccagcacaaggcctctcgaaa
accatctgtcctctttgcaacaccactgaacttctgttgcatattccagaaaaggccaat
tttaacacatgcactgagtgtcaaagcaccgtctgtagcctctgtggttttaaccccaac
cctcatttaactgagatcaaagagtggctctgtttaaactgtcagatgcaaagagctcta
ggaggggacctggcagcggcaatcccatcctcaccacagccaaccccaaaggccgccaca
gcacctacagcaacagccagcaaatcacctgtaccgtcacagcaggcttccccaaagaag
gaacctccatccaaacaggacagtcccaaagcactggagtcgaaaaaaccgccagagccg
aaaaaaccaccagagccgaaaaagccaccagagccgaaaaagccaccgccattggtgaaa
cagccaacccttcatggacctaccccagctacagccccacagcttccagtggcagaggcc
ttacctgagccagcccctcccaaggagccttctggacccctacctgaacaagccaaggcc
cccgttggagatgttgaaccaaagcagcccaagatgacagagacgcgcgcagacatccaa
tcttcgtcaacgacaaaacctgatattctgagctctcaagtgcagtcacaggctcaagtg
aaaacagcctctcctttgaaaacagactctgccaaaccttcacagagtttcccaccaaca
ggagaaaaaaccaccccacttgactctaaagccatgcccaggcctgcatcagactcaaaa
attatctcacaacctgggcccggttctgagagcaaggatccgaaacacattgatccgatt
cagaagaaagatgaacctaagaaagcacaacccaaggggagccctaaaccagaaacaaag
ccagtgccaaaaggatcaccgacaccctctggcacacgacctaccgctggccaagctgca
cccccatctcagcagcccccgaagcctcaggagcagtcaagacgttttagcttgaatctg
ggcggtatcactgatgcccccaaatcacagcccacgactcctcaagaaaccgtgacgggg
aaactcttcggctttggagcatccatctttagccaagcatcaaacttaatttccacagca
ggtcagcaaggaccacatccacaaactgggccagccgccccatcaaagcaagcccctacc
ccatcacagagtcctgctgctcagggacctgccaagtccacgggtcagctcccaccggca
cctgctaaggcgactgctgtgaagaaggaggcaaaagctgcagcagctgaaaacttagag
tccaaacctgagcaagcgccaacagcgaagaagacagagaaagacaagaagccgccacct
gcgaaggtcggcaaacctccaccctcagagcccgaaaaggctgtcccggcccataaacca
gacaagaccaccaaacccaaaccagcctgtcctctctgtagaactgagctcaacctaggg
tctcaggagcctcccaacttcaacacctgcacagaatgcaagaatcaagtttgcaatctc
tgtggatttaacccaacgccccacctgactgagattcaagagtggctttgtttaaactgc
cagacacagagagcaatttcaggacaacttggagatatgggcaaaatgccacctgcaccc
tcaggacccaaagcatcccctatgcctgctcctgcagaaccttcatcgcagaaaacaccc
acagggacccaagtgaaaggcaaaaagaaagaagcagaaggaaaaacggaagctgaaaaa
ccggttccagaaaaagaaacagcatcaattgagaaaacccctccaatggtcaccacagat
caaaaactagaagaaagtgaaggaaagaaaagcaaggtttcagcccttccggagaagaaa
ccatctgaagaagaaaaggcaatatctgcagataaaaaggaaaggaagccacctgctgaa
gaaaagccaccgcttgaagaaaagaagccaatccccgtagataagaaattacccccagaa
gcaaaaccgttgtcctcagagggggaagagaaacatgaaatacttaaagctcacgtacaa
attcccgaagaagaacccacaggcaaagtggctgcaaaggcaggtgaagaggagcagcag
ccagactccaggcctgaagctctgccaggcgccacacctctgacattacccaaggcagga
gagaaagaaagagcggtagcacagccacaggcagaaggcagttcaaaggatggccaaggc
gagcggagcaaagaaaagacagaaaaggaagaggataaatcagacacttccagttctcag
caacccaagagcccacaaggcctgagtgacacaggatattcttctgatggaatatcaggt
tcccttggggaaatcccaagccttatacccagtgatgagaaagatttgctgaaaggactc
aaaaaagattctttctcacaagaaagcagcccttccagcccctcagacttagctaagttg
gaaagtacagtactatccattttggaagctcaggcaagtacacttgttggtgaaaaagca
gaaaagaaaacacagccccagaagatttctcctgaaaagccacaggaccagcagaaaact
caaactgcatccgaaacactggatattactatttcagaagaggagatcaaagagagtcaa
gaaaagaaagttagtccaaaaaaggatagcgagcaaggttttccttccagaaaggagcac
aaagagaagcctgagctggttgatgacctaagtccgcgaagggcatcctatgattcggtc
gaagacagcagcgaaagtgaaaactcccctgttgtccgtaggaagcggagaactagtatt
ggttcgtcaagcagcgatgagtataagcaggaagacagtcaaggttcgggggaagaggag
gacttcattcgaaaacagattatagaaatgagtgctgatgaggatgcttcaggctctgag
gatgaagagttcatcaggagtcagctcaaagagatcagtggcgttggtgagagccagaag
agggaggaagcaaaggggaaaggaaaaggcgtggccgggaaacaccgacgactgactcga
aagagcagtaccagcttcgatgacgatgcagggaggcgtcattcctggcatgacgaggat
gatgaaacttttgatgaaagtcctgaactcaaattccgagaaactaaaagccaggagagt
gaagaactcgtcgtcgctggaggaggagggttgcggcgatttaagacaatagaactcaac
agtacaatagcagacaagtactcttcagaatcctctcagaaaaagacaattttgtatttc
gatgaagagccagaattagaaatggaaagtctgacagactcacccgaagacagatctagg
ggagagggatcctctagtctccatgcatccagcttcactcctggcacatcccctacgtca
gtatcgtcccttgatgaggacagtgacagtagcccaagtcacaaaaaaggagaaagcaag
cagcagcgcaaagctcggcacaggtcgcatggccctctgttacctaccattgaagattcc
tccgaggaagaagagctgagggaggaagaagaattactaaaagaacaagagaagcagcga
gaattggaacagcaacagaggaagagttctagtaagaaatcgaagaaagacaaagatgaa
cttcgagcccagagaaggcgagaaagaccaaagacaccgcccagtaatctctctcccatc
gaggacgcatcccccacagaagaactgcgccaggcagcagaaatggaggagctacacaga
tcctcttgctctgaatactcacctagcatagaatcagatccagaaggattcgaaataagc
cccgagaaaataatagaagttcaaaaagtttacaaattgcccgcagctgtgtctttatac
tcaccaacagacgagcaatctgttatgcagaaagaaggtgttcagaaggcattaaaaagt
gctgaggagatgtatgaagaaatgatgcagaaaccccacaagtacaaagctttcccagct
gcaaatgagagagatgaagtgtttgagaaagagccattgtacggtggtatgttaatagag
gactacatttacgagtctttagtagaggacacgtacaatgggtcagtagatggcagtctg
ctcaccaggcaagaggagcaaaacgggtttatgcagcagagagggagagaacaaaaagta
agactgcaggaacagatttacgatgaccccatgcagaaaatctcagacctccagaaggag
ttttatgaattagaaagcttacactctgttgtgcctcaagaagacattgtttcaagctct
tacatcattccagaaagccatgagatagtggatctgggtagcatggtgatgtctaccagc
gaagaaaagaaattgttagatgccgactcggcgtatgaagaactcatgaggcggcagcag
gtgcaggtaacagatggctccagccccgtacagactaccattggggatgacatggcagag
tccactctggacttcgacagggtgcaagatgcgtctttgacatcaagtatcctttctgga
gcatctcttacagactcaaccagcagtgcgactctctctatcccagatgttaagataacc
caacaattttcagcagaagaacttgaggatgaatatgtaactgattatacaagagaaatt
caagatataattgcccacgagtcacttatattgacttactctgagccttccgaaagtgcg
acgtctgtcccgccttctgacacaccttctctcacgtcctctatttcttcggtttgcacc
acagacagctcctcacctgtcactaccctcgacagcctaacaactgtttatacagagcca
gcagatgtaatgactaaatttaaagactctgaggaaatttcttcaacttattttccaggc
agcattatcgactatccagaagatataagtgtatctttagatcggaccatcatgccagaa
agtcgaactaatgaggatcggattgtgctttctttctccggtatggcaccttctgtcgta
gaatctgtaggaactaagcctgagaggccacaagctgacactatttccactgacttacct
atatctgaaaaggatttgataaaaggcaagaaagagactggggatgggattattttggaa
gttttggatgcttacaaagataagagggaagaatcagaggctgaactaacgaaaatcagc
ttgcctgagcctgggttggcccaagcgccttcttccgtaacagcccctcaaattaaggaa
caacatgtgtctccacattctgtatctggaaaaatttctggtcaggaaaagcccacatac
aggttaccatctggcagtcttcctgtttctacccatccatctaaatctcgtccgtttttc
cgaagttcttctttggacatatcagcccagccacctcctccccctccaccacctcctccc
tccccctccacctcgtcccctccacccaccccaccattgccaccagcaacttctcctaag
ccacccacttatcccaaaaaaaagttggcggttgcagctacagtgacttcaactactatt
gttacaacccatgttgatgctctaactatggtagaggccgcagctgctcgcaggagcaat
gggctgcctgccactaaaatgtgtgctattgcacctcctcctgtgcctcctaagccttct
caaattccaactggacttgtatttacacataggccagaggcaatcaaacctccaattgcc
cccaagccagcagttcctcagattccagttactacacagaaaccaacagatacgtgtccc
aagccaacaggtctatctttaacttcaactatgtccttaaatttagttacttcagcagac
tacaacgttccttcccctacctctccactttccccacactctaacaaatcctcaccaaga
tattctaagtctctcatggacacttacgtggttattacattgccctcggaacctgggact
ccaacagattcttctgctgcccaagccattacaagttggcccttgggatcacccccaaaa
gatctggtttcccttgaaacggtattttctgtagttcctcccatgacatctacagaaatt
ccaagtgcttcacagccaaccctatatacatctggagctttggggacattttctgttacc
cctgctgtaacagcctctttgtttcaaacagtaccaacttcacttacacagtttcttcca
gcagaagcttcaaaacccgaagtctctgcggtgagtagtgcagtcccaagtgttgctccc
aggagtgtttccataccaattcctccagagcctcttgctctagacaggcatcagtataag
gaaaatggaaagttgccacttattggagatgccattgatttgcgtacaataccaaaatca
gaagttaaagtaactgaaaaatgtatggatctttctgcttctgcaatggatgtgaaaagg
cagaccacagcgaatgaggtttacaggcgacaaattagtgctgtccaaccttctatcata
aacctcagtgcagcttcctccttaggaactccagtcaccatggactctaagacagtggct
gttgtcacgtgcacagacactacaatttacacaacaggcacagaaagccaagtgggtata
gaacatgcagtaacatcaccactgcagcttactacatcaaaacatactgagttaccatac
aggaaacctagtagccaggcttttcctacaatccgagatgaagcacccatcaacttatca
ttaggtccttcagctcaggcagtgacgctggctgtcacgaagcccgtcactgtacctcct
gtcggcgtcacaaatggatggactgacagcactctatctcagggggtcgctgatggagaa
gtagtagatctcagcacatcaaaatctcacagaactgtcgtgacaatggatgaatctacg
tcaaacgtggtgaccaaaatcatagaggatgatgaaaaaccagttgatctgaccgcagga
agacgagcggtgtgctgtgatatggtttacacgttgccctttggaaggagctgcacggca
cagcagcctgcaaccacccttcccgaagaccgttttggttacagggatgaccactatcaa
tatgacagatcagggccctatggttacagggggattggcggaatgaaaccttccatgtca
gataccaatttaccagaagctggacactttttctataaaagtaagaatgcctttgattat
tctggaggaactggtgcagcagtagacctgacttctgggagagtgtctacaggtgaggta
atggattattcaagcaagactacaggtccatacccagaaacacgccaagtcatttcggga
gttgggattagtaccccacagtattccactgcaagactgactccacctcctggaccccag
tatggtgtgggaagtgttttgaggtcatctaatggtgttgtctattcttcagtagcaact
ccaatcccctccacatttgctatcaccactcaaccgggctctattttcagcaccacggtc
agggatttatctggcattcctaccacagatgcaatgacttcattatcagccctgcatcaa
agccagccaatgcctcgatcgtatttcataacaacaggtgcgtcagaaacagacatcgca
gtaaccggtattgacatcaatgccagtctgcaaactattaccatggaaactcttcctgct
gagacaatggactctgttcctaccttaaccacagcgtctgaggtgttttctgaggtggtc
ggagaggaaagcacccttctaattgtccctgatgaagacaaacaacaacagcaacttgac
ttggagcgagagctcctggaactggagaaaattaagcaacaacgctttgctgaagaactg
gagtgggaacgtcaggagattcagaggttccgagaacaagagaagatcatggttcaaaag
aagctggaggagctgcagtctatgaagcagcaccttctctatcaacaagaggaagagcgg
caggcacagttcatgatgaggcaggagacgctagctcagcaacagttacagcttgagcag
atccaacagctgcaacaacagctccaccagcagctcgaggaacaaaaacttcgccagatc
taccagtataattatgacccctctgggacctcttctcctcaaaccaccactgaacaggcc
attttagagggtcaatatgctgctacagagggcagtcagttttgggccactgaagatgcc
accactacggcgtctactgtggtagccattgaaatcccacagagccaaggatggtacacc
gttcagtctgatggtgtgactcagtacattgccccacctggtatcctgagcactgtttca
gagatacctctgacagatgttgttgtgaaagaggagaagcaacccaaaaagagaagttct
ggagctaaagttcgggggcagtatgatgagatgggggaaagcgtggcagacgatccacga
aatttaaaaaagatagtggacagtggcgtgcaaactgacgacgaagaaactgctgatcgg
agttacgcaagtaggagaagaagaactaaaaaaagcgtggataccagtgtccaaactgat
gacgaagatcaggatgagtgggacatgccttctaggtccaggagaaaagcgcgaacaggg
aaatacggagatagcaccgcagagggtgacaagaccaagcccctttccaaagtctccagt
gtagcggttcagacagttgcagagatatctgtgcaaactgagccagtgggaaccataaga
acaccttccatacgagcacgggtggatgccaaggtagaaataattaaacacatttcagca
cctgaaaagacttacaaagggggcagtttaggatgccaaacagaaacagattcagacaca
cagagccctccatatctgggtgccacatctccacccaaagacaagaaacgcccaacacct
ttagaaattggttattcttcttctcaccttcgggcagaccccacagtccagctggctcct
tccccacccaaatctccaaaagtcctttactcacccatctcaccactttccccaggcaac
gccttagaaccagcctttgtaccttatgaaaaacccctccctgatgacataagtccacag
aaagtactccatccagatatggctaaagttcccccggcaagccctaagacagccaagatg
atgcagcgttcaatgtctgacccaaagcctctgagtccaacagcagacgaaagttccagg
gctccttttcagtattccgagggcttcacgactaaaggttcccaaaccatgacagcctct
ggtactcagaaaaaagtgaagagaacacttccaaatccccctcctgaggaggtgtccacg
ggaacacagtcaacttacagcaccatgggcactgcttctaggagaagaatgtgcagaacc
aataccatggctcgagccaagattctccaggacatagaccgagagctcgacctcgtggaa
agggagtctgccaagcttagaaagaagcaagcagaacttgatgaagaagaaaaggagatt
gatgccaagctgcggtatctggaaatgggaattaacaggagaaaagaagcgttattgaag
gagagagaaaagagagagcgtgcctacctgcagggggtagctgaggaccgcgattacatg
tctgacagtgaggtcagcagtaccagaccgagccgagtagaaagtcagcacggcgttgag
cggccaagaacagctcctcaaactgaattcagtcagttcataccaccacagacccaaaca
gaagctcaactagttcctcctacaagtccttacacacaataccagtactcatcaccggcc
cttcccacccaagccccgaccccatacacacagcaatctcattttcaacagcagacacta
taccatcagcaagtttcaccttatcagactcagccaaccttccaagctgtggcaacaatg
tccttcacaccccaggctcaacccactccaactccacagccatcctatcaactaccgtca
cagatgatggtgatacaacagaagcctcgacaaaccacattgtatttggagcctaagata
acttctaactatgaagtgattcgcaaccaacccctgatgatcgctccggtttctactgat
aatacatacgctgtttcccatcttgggagtaagtacaatagtttagacttgagaatcggt
ttggaggaaagaagcagcatggcaggcagtccaatatcaagcatatctgcagactccttc
tatgcagacattgaccaccacacttcaaggaattatgtcctaatagatgacattggagac
attaccaaagggacagcagcactgagcactgtatttagtcttcatgaaaaggatctgtca
aaaacagatcgtctccttagaaccactgagacacggaggtctcaggaagtgacagacttc
ctagcgcctttgcagacttcctccagattgcatagctatgtgaaagcagatgaggatcca
atggaggatccttatgagttaaagcttctgaaacatcagattaagcaagaattccgtaga
ggcactgagagcttggatcaccttgctggtctctcacattattaccatgccgatactagc
tataggcactttcccaagtctgaaaagtatagcatcagtagactcacccttgagaagcaa
gctgccaaacaattacctgcagccatactttaccaaaagcaatcaaagcataagaaatca
ttaattgaccctaaaatgtcaaagttttcacctattcaagaaagtagagaccttgaacct
gactatcccacttacatgagttctggcacttcatccattggtggcatttcttctagggca
aggcttcttcaagatgatatcacatttggcctcagaaaaaatattacagatcaacaaaaa
tttatgggctcatcacttgggtcaggactgggcacactaggaaatactatccggtcagct
ctacaggatgaagcagataaaccatacagtagtggcagcaggtccaggccttcctccagg
ccttcttctgtctatggccttgatttatcaattaagagggattcttctagctcatcgcta
agattgaaagctcaagaggctgaagctctggatgtctcctttggccattcttcatcttct
gccagaactaagcccaccagcttaccaatcagccagagcagaggaagaataccaattgtg
gcccagagttcagaagaagaaagtccgctaagtcctgttggccaaccaatgggaatggcc
agggctgcggctggacctttgccgcccatatctgcagatacgagggatcagtttggatca
agccactcattgcctgaagttcagcaacacatgagagaagagtcacggacaaggggttat
gaccgtgacatagcattcatcatggatgacttccaacatgctatgtcagacagtgaagcc
tatcacttgcgtcgggaggaaacggattggtttgataaacccagggagtctcggttggaa
aatggccatggtctggataggaaactgccagaaagactggttcactctagacccctcagt
caacaccaggagcaaattctgcagatgaatggaaagacaatacattacatctttcctcat
gcaagggttaaaatcaccagagacttcaaggaccacactggttcaggtaatgggctagga
attagaattgttggtggtaaagaaatccctggacacagtggagaaattggagcctatatt
gctaagattcttcctggtgaaagtgcggaacacacggggccccttatggaagggatgcaa
gtattggagtggaatggggtccccttgacttctaaaacatatgaagaagtgcagagtatc
attaaccaacaaagtggggaagcagaaatatgtgtaagactggacctcaatatgttgtcg
gattccgaaaatccccagcatctggaacttcatgaaccgccaaaagttgataaggcaaag
tctccaggcgtggatcccaagcagttggcggcagagctgcagaaagtctcactccagcag
tccccactggtcatgtcgtcagtcgtggagaaagggtctcatgctcactcaggtcccaca
tcagcaggatccagttctgttcccagccccgggcagccagggtcgccttcagtaagcaaa
aagaagcatagcagtaccaagcctactgatggaccaaaggctgcctctcacccaattaca
ggagagattcagcttcaaatcaactacgatcttggaaatcttataatacatatccttcaa
gcaagaaacctagtccccagagacaacaatggctactctgacccgtttgttaaggtgtac
ctacttccagggagaggtcaagtcatggttgtccagaatgcaagtgctgagtacaagaga
aggacaaaatatgtccagaaaagtcttaatcctgagtggaatcaaacagtaatttataaa
agtatttccatggagcagctcatgaagaagaccttggaggtgacagtttgggattatgat
agattctcttccaacgacttccttggagaggtattgattgatttatctagcacatctcat
ctggacaacactcctcggtggtatcctctgaaagaacaaactgagagcattgaccatggc
aagtctcactccagtcaaaacagccagcagtccccaaagccctctgtgatcaaaagcaga
agccacggtatcttccctgacccatccaaggacatgcaggttcccaccattgagaagtcc
cacagtagtcctgggagctcaaaatcatcatctgaaggccatctccgatctcacggacca
tctcgcagtcaaagcaaaaccagtgtcgcccagacccacctggaagatgcaggggtggcc
atagccgcagctgaagccgctgtgcaacaactccgcattcaaccaacaaagcccaccaac
caccggcctgcagagagctccgtgtcaaccggctcctcgggcagcagcgttggcagtggg
tatagcgtggacagcgaaggaagcagctgtgtggccggggagcccaatctacttcccatc
ccgaggataggaaagatgggacagaatggacaggaccctgtgaaacagccaggaatggga
gcaacagacacagagggtaaaactcaagtaatgggagaaatcaagctagcattgaagaag
gaaatgaaaacagatggtgaacagctaatagttgaaattctccagtgcagaaatattacc
tacaaatttaagtctccagatcatttaccagatttatatgtgaaactatatgtgataaac
atctctacccaaaaaaaggttattaaaaagaagacaagggtatgccgacatgatcgagag
ccttcttttaatgaaacttttagattcagcctaagtcctgcgggccattcgcttcagatt
ttacttttctccaatggagggaagtttatgaagaagacgttgattggagaagcatgtatc
tggcttgacaaagtggatctgaggaaaagaatagtcaattggcacaaattgttggtgagt
cccactcaaacacactga

DBGET integrated database retrieval system