KEGG   Rattus norvegicus (rat): 56781
Entry
56781             CDS       T01003                                 

Gene name
Myl1, MLC-f, MLC3-f, MLCf, Mcl3, Mlc1, Mlc3
Definition
(RefSeq) myosin, light chain 1
  KO
K05738  myosin light chain 1
Organism
rno  Rattus norvegicus (rat)
Brite
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     56781 (Myl1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_9 EF-hand_8
Other DBs
NCBI-GeneID: 56781
NCBI-ProteinID: NP_001071124
RGD: 1598796
Ensembl: ENSRNOG00000013262
UniProt: P02600
Position
9q32
AA seq 189 aa
MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRT
GECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKD
QGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYE
AFVKHIMSV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcaccaaagaaagacgtgaagaagcccgctgctgctgctcctgccccagccccggcc
ccggcccctgccccagccaaacctaaagaagaaaaaatcgatctgtctgctattaagatc
gagttctctaaggaacaacaggaggaattcaaggaggcatttctcctcttcgacagaacc
ggtgaatgcaagatcaccttaagtcaggtgggcgacgtcctccgggctctgggcaccaat
cccacaaatgcagaagtcaagaaggttctcgggaaccctagcaatgaagagatgaatgct
aagaaaatcgagtttgaacagtttctgcccatgatgcaagccatctccaacaacaaggac
cagggaggctatgaagatttcgttgagggtctgcgtgtcttcgacaaggagggcaatggc
accgtcatgggtgctgagctccgccatgtcctcgccactctgggagagaagatgaaggag
gaggaggtagaagcattgctggcgggccaggaggactccaatggctgcatcaactatgaa
gcttttgtgaaacacatcatgtctgtctaa

DBGET integrated database retrieval system