KEGG   Rattus norvegicus (rat): 56823
Entry
56823             CDS       T01003                                 

Gene name
Haao
Definition
(RefSeq) 3-hydroxyanthranilate 3,4-dioxygenase
  KO
K00452  3-hydroxyanthranilate 3,4-dioxygenase [EC:1.13.11.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
rno_M00912  NAD biosynthesis, tryptophan => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    56823 (Haao)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.6  3-hydroxyanthranilate 3,4-dioxygenase
     56823 (Haao)
SSDB
Motif
Pfam: 3-HAO Cupin_2 Cupin_3 AraC_binding Cupin_1
Other DBs
NCBI-GeneID: 56823
NCBI-ProteinID: NP_064461
RGD: 71071
Ensembl: ENSRNOG00000031263
UniProt: P46953
Position
6q12
AA seq 286 aa
MERCVRVKSWVEENRASFQPPVCNKLMHREQLKIMFVGGPNTRKDYHIEEGEEVFYQLEG
DMVLRVLEQGEHRDVVIRQGEIFLLPARVPHSPQRFANTMGLVIERRRMETELDGLRYYV
GDTEDVLFEKWFHCKDLGTQLAPIIQEFFHSEQYRTGKPNPDQLLKEPPFPLSTRSVMEP
MSLKAWLESHSRELQAGTSLSLFGDSYETQVIAHGQGSSKGPRQDVDVWLWQLEGSSKVT
MGGQCVALAPDDSLLVPAGFSYMWERAQGSVALSVTQDPACKKPLG
NT seq 861 nt   +upstreamnt  +downstreamnt
atggagcgctgtgtgagagtgaagtcttgggtagaagagaatcgggcctcctttcagcct
ccggtttgcaacaagcttatgcaccgggagcagctcaaaatcatgttcgtcggaggcccc
aacaccaggaaggattatcacattgaagagggagaggaggtgttttaccagctggaggga
gacatggtgctccgagtcctcgagcaaggagaacaccgggatgtggttatacgacaggga
gagatattcctcctgcctgccagggtgccccactccccgcagaggtttgccaacaccatg
ggcctggtgattgagagaaggcgaatggagaccgagctggatgggctgaggtactatgtg
ggcgacactgaggatgtcctcttcgagaaatggttccactgtaaggaccttgggacgcag
ttagcccccatcatccaagagttcttccactctgagcagtaccgaacaggaaagcccaac
cctgaccaactgctcaaggagccgccattcccgctgagtacacggtccgtaatggagccc
atgtcactgaaggcctggctggagagccactccagggagcttcaggcaggcacatcccta
agcctgtttggggacagctatgagactcaggtcatcgcccacggacaaggcagcagcaaa
ggcccgagacaggatgtagatgtgtggctgtggcaactggagggctcctctaaggtgaca
atgggaggacagtgtgtggccctggccccagatgacagcctgctggtgcccgctgggttc
tcgtacatgtgggagcgagcgcaaggctctgtggccttgtctgtgacacaagaccctgcc
tgtaagaagccactggggtga

DBGET integrated database retrieval system