KEGG   Rattus norvegicus (rat): 57027Help
Entry
57027             CDS       T01003                                 

Gene name
Adam17, TACE
Definition
(RefSeq) ADAM metallopeptidase domain 17
  KO
K06059  disintegrin and metalloproteinase domain-containing protein 17 [EC:3.4.24.86]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04330  Notch signaling pathway
rno05010  Alzheimer disease
Module
rno_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    57027 (Adam17)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    57027 (Adam17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    57027 (Adam17)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    57027 (Adam17)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.86  ADAM 17 endopeptidase
     57027 (Adam17)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   57027 (Adam17)
CD molecules [BR:rno04090]
 Proteins
  57027 (Adam17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin_5 Reprolysin_2 ADAM17_MPD Disintegrin Reprolysin_3 Reprolysin Pep_M12B_propep Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 57027
NCBI-ProteinID: NP_064702
RGD: 620404
Ensembl: ENSRNOG00000060694
UniProt: Q9Z1K9
Position
6q16
AA seq 827 aa AA seqDB search
MRQRLLFLTTLVPFVLAPRPPEEPGSGSHLRLEKLDSLLSDYDILSLSNIQQHSIRKRDL
QSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQDFFSGHVV
GEPDSRVLAHIGDDDVTVRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKDFSRLQS
PKVCGYLNADSEELLPKGLIDREPSEEFVRRVKRRAEPNPLKNTCKLLVVADHRFYKYMG
RGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGVQIEQIRILKSPQEVKPGERHFNM
AKSFPNEEKDAWDVKMLLEQFSLDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANS
HGGVCPKAYYNPGVKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGL
AECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKTIESKAQECFQERSNKVCGN
SRVDEGEECDPGIMYLNNDTCCNSDCTLKPGVQCSDRNSPCCKNCQFETAQKKCQEAINA
TCKGVSYCTGNSSECPPPGDAEDDTVCLDLGKCKAGKCIPFCKREQELESCACADTDNSC
KVCCRNLSGPCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKCEKRVQDVIERFWDFIDQLS
INTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVDKKLDKQYESLSLFHHSNIEMLSSMD
SASVRIIKPFPAPQTPGRLQALQPAAMMPPVSAAPKLDHQRMDTIQEDPSTDSHVDDDGF
EKDPFPNSSAAAKSFEDLTDHPVTRSEKAASFKLQRQSRVDSKETEC
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagcgtctcctcttcctgaccactttggtgcctttcgtcctggcaccccgacct
ccggaggaaccaggctctggctcccacctgcgacttgagaagcttgattctttgctctca
gactacgatatcctctctttatctaatatccagcagcactccataaggaaaagggatcta
cagtctgcgacacacttagaaacactactaactttttcagctttgaaaaggcattttaaa
ttatacttgacatcaagtacagaacgcttttcacagaacttgcgagtcgtggtggtggat
gggaaagaggaaagcgagtacagtgtgaagtggcaggacttcttcagcggacatgtggtt
ggtgagcctgactctagggttctagcgcacataggagatgatgatgtcacagtaagaatc
aacacagatggggcagaatataacatagagccactttggaggtttgttaatgatactaaa
gataaaaggatgctggtgtataagtctgaagatatcaaggatttttcacgtttgcagtct
ccaaaagtatgtggttatttaaatgcagatagtgaagagttgcttccaaaagggctcata
gacagagagccatctgaagagtttgtccgtcgagtgaagaggcgagctgaacctaaccca
ttgaagaatacttgtaaattactggtggtggcagatcatcgattttataagtacatgggc
cgaggagaagagagcactactacaaattacttaatagagttaattgaccgagttgatgac
atataccggaacacctcgtgggacaatgcaggatttaaaggttatggagtacagatagaa
cagattcgaattctcaagtctccacaagaggtaaaacctggtgaaagacacttcaatatg
gcaaaaagttttccaaatgaagaaaaggatgcttgggatgtgaagatgctgctggagcaa
tttagccttgatatagctgaagaggcctctaaagtctgcctggctcatcttttcacctac
caagattttgatatgggaactcttggattagcttacgttggttctcccagagcaaacagt
catggaggggtttgtccaaaagcttattacaacccaggtgtgaagaagaacatctatttg
aatagtggtctgacaagtacaaaaaattatggtaaaaccatccttacaaaggaggctgac
ctggttacaactcatgaattgggacacaattttggagcagaacatgatcctgatgggctg
gcagagtgtgccccaaatgaggaccaaggaggaaagtatgttatgtaccccatagctgtg
agtggtgaccatgagaataataagatgttttcaaactgcagtaaacagtccatctacaag
accatagaaagcaaggctcaagagtgcttccaggagcgcagcaacaaggtgtgcggcaac
tccagggtggacgaaggagaagagtgtgacccgggcatcatgtacctgaacaacgacacc
tgctgcaatagtgactgcacactgaagccaggtgtgcagtgcagtgataggaatagtcct
tgctgtaaaaattgtcagtttgagacggcccagaagaagtgccaggaggctatcaatgct
acttgcaaaggagtgtcttactgcacagggaatagcagtgagtgccccccaccaggagat
gctgaagatgacactgtgtgcttggacctgggcaagtgcaaggctgggaaatgcatccct
ttctgcaagagggagcaggagctggagtcctgcgcatgtgctgacaccgacaactcgtgc
aaggtatgctgcaggaacctttctggcccatgtgtgccttacgtcgatgcagagcaaaag
aacttatttttgaggaaagggaagccctgtacagtagggttttgtgacatgaatggcaaa
tgtgagaaacgggtacaggacgtaattgagcggttttgggatttcattgaccagctgagc
atcaacacttttgggaagtttctggcagacaacatcgttgggtctgttctggttttctcc
ttgatattttggattcctttcagcattcttgtccactgtgtggataagaaactggacaag
cagtatgagtccctgtctctgtttcatcacagtaacattgagatgttgagcagcatggac
tcagcatctgttcgcattatcaagccgttccctgcaccccagactccaggtcgtctgcag
gccctgcagccggctgcaatgatgccgccagtgtctgcggctccaaaactggatcaccag
aggatggacaccatccaggaagaccccagcacagattcacatgtggatgatgatggcttt
gagaaggaccccttccccaacagcagtgcagccgccaagtcctttgaggacctcacagac
cacccagtcaccaggagtgagaaggccgcctccttcaagctgcagcgtcagagccgagtt
gatagcaaagagacagagtgttag

DBGET integrated database retrieval system