KEGG   Rattus norvegicus (rat): 57300Help
Entry
57300             CDS       T01003                                 

Gene name
Aadac, Aada
Definition
(RefSeq) arylacetamide deacetylase
  KO
K13616  arylacetamide deacetylase [EC:3.1.1.3]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    57300 (Aadac)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     57300 (Aadac)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   57300 (Aadac)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 AXE1 Chlorophyllase2 Esterase_phd
Motif
Other DBs
NCBI-GeneID: 57300
NCBI-ProteinID: NP_065413
RGD: 631440
Ensembl: ENSRNOG00000013950
UniProt: Q9QZH8
Position
2q31
AA seq 398 aa AA seqDB search
MGRTIFLLISVVLVAYYIYIPLPDDIEEPWKIILGNTLLKLGGDLASFGELLGLNHFMDT
VQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKSTTLRRGLFFIHGGGWCLGSAA
YFMYDTLSRRTAHRLDAVVVSTDYGLAPKYHFPKQFEDVYHSLRWFLQEDILEKYGVDPR
RVGVSGDSAGGNLTAAVTQQILQDPDVKIKLKVQALIYPALQALDMNVPSQQENSQYPLL
TRSLLIRFWSEYFTTDRDLEKAMLLNQHVPVEFSHLLQFVNWSSLLPQRYKKGYFYKTPT
PGSLELAQKYPGFTDVKACPLLANDSILHHLPMTYIITCQYDVLRDDGLMYVKRLQNTGV
HVTHHHIEDGFHGALTLPGLKITYRMQNQYLNWLHKNL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaactatttttcttctcatctctgtggtgcttgtagcttattatatttatata
cctctcccagatgatattgaagagccttggaaaataatattgggaaatacacttctaaaa
cttggaggagatttggcttcttttggtgaacttttgggactcaatcatttcatggacacg
gtacagttatttatgagatttcaagttgtcccacccacttctgatgagaatgtcactgtg
atggagacagatttcaacagtgttcctgttcgcatatatatacccaaaaggaagtcaacg
acgctcaggaggggcttgttttttattcatggtggtggctggtgtctggggagtgctgct
tacttcatgtatgacactctgtcaagacggactgcccatagacttgatgccgttgttgtg
tcaactgactatggcttagccccaaaataccattttccaaaacagtttgaagatgtatat
catagtttacgatggttcttacaagaggacattcttgaaaaatatggtgtagatcctaga
agagttggtgtgtctggggacagtgctggtggaaacttaactgcagctgtgacacaacag
attctacaggatccagatgtcaagatcaaactcaaggtccaagctttaatatatcctgcc
cttcaggctcttgatatgaatgtaccatcacaacaagaaaattcacaatacccactttta
accaggtcattattgatccgtttctggagtgaatactttactacagaccgagaccttgag
aaagccatgcttctcaaccaacatgtacctgtggaattcagccatttgttacaatttgtg
aattggagttccttgctccctcagagatataagaaaggttacttttataaaactcccact
cctggtagtttggagctggctcaaaagtacccagggttcacagatgtaaaggcatgccct
ctgttggccaatgacagtatattacatcatttacctatgacctatattatcacttgtcag
tatgatgttctaagagatgacggactcatgtatgtcaagcggcttcagaatactggagtt
catgtgactcatcaccatattgaagatggattccatggagcacttaccttacctggtttg
aaaattacatacaggatgcaaaatcagtacttgaattggcttcacaaaaatctgtag

DBGET integrated database retrieval system