KEGG   Rattus norvegicus (rat): 57302Help
Entry
57302             CDS       T01003                                 

Gene name
Cnr2, CB-2, CB2, CB2C, CNR2C
Definition
(RefSeq) cannabinoid receptor 2
  KO
K04278  cannabinoid receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57302 (Cnr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    57302 (Cnr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Cannabinoid
    57302 (Cnr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 57302
NCBI-ProteinID: NP_001157614
RGD: 619713
Ensembl: ENSRNOG00000009260
UniProt: Q9QZN9 C6G964
Position
5q36
AA seq 360 aa AA seqDB search
MAGCRELELTNGSNGGLEFNPMKEYMILSDAQQIAVAVLCTLMGLLSALENVAVLYLILS
SQRLRRKPSYLFIGSLAGADFLASVIFACNFVIFHVFHGVDSRNIFLLKIGSVTMTFTAS
VGSLLLTAVDRYLCLCYPPTYKALVTRGRALVALGVMWVLSALISYLPLMGWTCCPSPCS
ELFPLIPNDYLLGWLLFIAILFSGIIYTYGYVLWKAHQHVASLAEHQDRQVPGIARMRLD
VRLAKTLGLVMAVLLICWFPALALMGHSLVTTLSDKVKEAFAFCSMLCLVNSMINPIIYA
LRSGEIRSAAQHCLTGWKKYLQGLGSEGKEEAPKSSVTETEAEVKTTTGPGSRTPGCSNC
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatgccgggagctggagttgaccaacggctccaatggcggcttggagttcaac
cctatgaaggagtacatgatcttgagtgatgcgcagcagatcgctgtggcggtgctgtgt
accctgatggggctgctgagtgccctggagaacgtggctgtgctctatctcatcctgtcc
tcgcagcggctccgcaggaagccctcgtacctgttcatcggcagcttggccggagctgac
ttcctggccagcgtgatctttgcctgcaacttcgtcatcttccatgtctttcacggtgtg
gactccaggaatatcttcctgttgaagatcggcagcgtgaccatgaccttcacggcctct
gtgggcagcctgctgctgaccgctgttgaccgatacctatgtctgtgctacccacctacc
tacaaagctctcgtcacccgtgggagggcactggtggcccttggtgtcatgtgggtcctc
tcggcgttgatctcctacctaccgctcatggggtggacttgttgtcctagtccctgttct
gaacttttccccctgatccccaacgactacctcctgggctggcttcttttcattgccatc
ctcttttctggcatcatctatacctatgggtatgtcctctggaaagcacaccaacatgta
gccagcttggctgagcaccaggacaggcaggtgcctgggatagctcggatgcggctagac
gtgaggttggccaagactctgggcctggtcatggctgttctgctcatatgctggttccct
gcactggctctcatgggccatagcctggtcaccacactgagtgacaaggtcaaggaggcc
ttcgccttctgctccatgctgtgccttgttaactccatgatcaatcctatcatttatgcc
ctgcggagtggagagatccgctctgctgcccagcactgcctgacaggctggaagaaatat
ctccagggcctcggatctgaggggaaagaagaagccccaaagtcctcagttacagagaca
gaggctgaggtgaaaaccaccacagggccgggatccagaacaccaggctgctccaattgc
tga

DBGET integrated database retrieval system