KEGG   Rattus norvegicus (rat): 57305Help
Entry
57305             CDS       T01003                                 

Gene name
Uts2r, Gpr14, Senr, UR-2-R
Definition
(RefSeq) urotensin 2 receptor
  KO
K04241  urotensin 2 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57305 (Uts2r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    57305 (Uts2r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Urotensin II
    57305 (Uts2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF4778
Motif
Other DBs
NCBI-GeneID: 57305
NCBI-ProteinID: NP_065412
RGD: 621884
Ensembl: ENSRNOG00000036669
UniProt: P49684
Position
10q32.3
AA seq 386 aa AA seqDB search
MALSLESTTSFHMLTVSGSTVTELPGDSNVSLNSSWSGPTDPSSLKDLVATGVIGAVLSA
MGVVGMVGNVYTLVVMCRFLRASASMYVYVVNLALADLLYLLSIPFIIATYVTKDWHFGD
VGCRVLFSLDFLTMHASIFTLTIMSSERYAAVLRPLDTVQRSKGYRKLLVLGTWLLALLL
TLPMMLAIQLVRRGSKSLCLPAWGPRAHRTYLTLLFGTSIVGPGLVIGLLYVRLARAYWL
SQQASFKQTRRLPNPRVLYLILGIVLLFWACFLPFWLWQLLAQYHEAMPLTPETARIVNY
LTTCLTYGNSCINPFLYTLLTKNYREYLRGRQRSLGSSCHSPGSPGSFLPSRVHLQQDSG
RSLSSSSQQATETLMLSPVPRNGALL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagcctggagtctacaacaagctttcatatgctcaccgtgtccggaagcact
gtgactgagctgcctggtgactccaacgtgtccctcaacagttcctggtccggcccaaca
gatcccagctccctgaaagaccttgtggccacgggtgtcatcggggcagtgctctcagcc
atgggtgtggtgggcatggtgggaaatgtatacactttggtggtcatgtgccggtttctg
cgtgcctcggcctccatgtacgtctatgtggtcaacctagcgctggctgatctgctgtac
ctgctgagcattcccttcatcatagccacctacgtcactaaggactggcactttggagat
gtgggctgcagagtcctctttagcctggacttcctgacaatgcacgccagcatcttcacc
ctgaccataatgagcagcgaacgctatgcagccgtactgaggcctctggacacagtccag
cgctccaagggttaccgtaagctgctggtgctgggcacctggttgctggcactgctgctg
accctacccatgatgcttgccatccagctggtccgcaggggctctaagagcctctgcctg
ccagcctggggccctcgtgcccaccgtacttacctaacgttgctctttgggaccagcatt
gtggggcctggcttggtcattgggctgctctatgtccgtctggccagggcctactggcta
tctcagcaagcttctttcaagcagacacggcggctgcccaaccccagggtgctctacctc
atccttggtatcgtccttctcttctgggcctgctttctacccttctggctgtggcagctg
ctggcccagtaccacgaggccatgccactgactcccgagactgcacgcattgtcaactac
ctgaccacctgcctcacttatggcaacagttgcatcaatcccttcctctacactctgctc
accaagaactatcgagagtacctacgtggccgccagcggtcactgggtagtagttgccac
agcccagggagtcctggcagcttcctgcccagccgagtccacctccagcaggactcgggc
cgctcgctgtcctccagcagccaacaggccacagagaccctcatgctgtctccagtcccc
cgtaacggggcccttctctga

DBGET integrated database retrieval system