KEGG   Rattus norvegicus (rat): 574523Help
Entry
574523            CDS       T01003                                 

Gene name
Ugt1a5, UDPGT_1-5, Ugt1, Ugt1a6
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A5
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00053  Ascorbate and aldarate metabolism
rno00140  Steroid hormone biosynthesis
rno00830  Retinol metabolism
rno00860  Porphyrin and chlorophyll metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Module
rno_M00014  Glucuronate pathway (uronate pathway)
rno_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574523 (Ugt1a5)
   00053 Ascorbate and aldarate metabolism
    574523 (Ugt1a5)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    574523 (Ugt1a5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574523 (Ugt1a5)
   00860 Porphyrin and chlorophyll metabolism
    574523 (Ugt1a5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574523 (Ugt1a5)
   00982 Drug metabolism - cytochrome P450
    574523 (Ugt1a5)
   00983 Drug metabolism - other enzymes
    574523 (Ugt1a5)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    574523 (Ugt1a5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    574523 (Ugt1a5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574523 (Ugt1a5)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   574523 (Ugt1a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Pox_A14
Motif
Other DBs
NCBI-GeneID: 574523
NCBI-ProteinID: NP_001034638
RGD: 1583689
Ensembl: ENSRNOG00000018740
UniProt: Q6T5F0
Position
9q35
AA seq 531 aa AA seqDB search
MGLHVTLQGLAGLLLLLYALPWAEGGKVLVFPMEGSHWLSMRDVVRELHARGHQAVVLAP
EVTVHIKEEDFFTLQTYPVPYTRQGFRQQMMRNIKVVFETGNYVKTFLETSEILKNISTV
LLRSCMNLLHNGSLLQHLNSSSFDMVLTDPVIPCGAVLAKYLGIPTVFFLRYIPCGIDSE
ATQCPKPSSYIPNLLTMLSDHMTFLQRVKNMLYPLALKYICHFSFTRYESLASELLQREV
SLVEVLSHASVWLFRGDFVFDYPRPVMPNMVFIGGINCVIKKPLSQEFEAYVNASGEHGI
VVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLG
HPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADD
LENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLT
WYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgggactccatgtgaccctgcaaggattagctgggctgctgctgctgctgtatgccctg
ccctgggctgaaggtggaaaggtgctggtgtttcccatggagggcagccactggctgagc
atgagggatgtcgtgagggagctccacgcccgaggtcaccaggctgtggtcctggctcca
gaggtgactgtgcacatcaaagaagaggacttcttcaccctccaaacctaccctgttcca
tacacaagacaaggatttagacaacaaatgatgcgaaacattaaagtggtctttgaaaca
ggcaactatgtgaagacattccttgaaacatccgagattttgaaaaacatatcgacagtt
ctcttaaggtcttgtatgaatctattgcacaatgggtccctgctccagcatctgaattcc
agctcctttgacatggtcttaacagatcctgtgattccgtgtggggcagtgctggccaag
tacttgggtatccccactgtgttctttctacgatacattccctgtggcatagactctgag
gccacacaatgtccgaaaccttcctcttatattccgaacctactcacaatgctttctgac
cacatgactttcctgcaaagggtcaagaacatgctgtaccctctggccttgaagtacatt
tgccatttctcattcactcgctatgaaagcctggcctctgagcttttgcagagagaagtg
tctttagtggaggttctcagccatgcatctgtgtggctgttccgaggggactttgtgttc
gactacccgaggcctgtcatgcctaacatggtcttcattggaggcataaactgtgtcatc
aagaagcctctttctcaggaatttgaagcctatgtcaacgcctccggagaacatggcatc
gtggttttctctttgggatccatggtctcagagattccagagaagaaagcgatggaaatt
gctgaggctttgggcagaattcctcagacggtcctgtggcgctacaccggaactagacca
tcgaaccttgcaaagaacactattcttgtcaaatggctaccccaaaacgatctgcttggt
catccaaaggctcgggcgttcatcacacactccggttcccatggtatttatgaaggaata
tgcaatggggttccaatggtgatgatgcccttgtttggtgatcagatggacaacgccaag
cgcatggaaactcggggagctggggtgaccctgaatgtcctggaaatgactgccgatgat
ttggaaaacgcccttaaaactgtcatcaataacaagagttacaaggagaacatcatgcgc
ctctccagccttcacaaggaccgtcctatcgagcctctggacctggctgtgttctgggtg
gagtacgtgatgaggcacaagggggcgccacacctgcgccccgccgcccacgacctcacc
tggtaccagtaccactccttggacgtgattggctttctcctggccatcgtgttgacggtg
gtcttcattgtctataaaagttgtgcctatggctgccggaaatgctttgggggaaagggt
cgagtgaagaaatcacacaaatccaagacccactga

DBGET integrated database retrieval system