KEGG   Rattus norvegicus (rat): 58813Help
Entry
58813             CDS       T01003                                 

Gene name
Nt5e, CD73, Nt5
Definition
(RefSeq) 5' nucleotidase, ecto
  KO
K19970  5'-nucleotidase [EC:3.1.3.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    58813 (Nt5e)
   00240 Pyrimidine metabolism
    58813 (Nt5e)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    58813 (Nt5e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    58813 (Nt5e)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    58813 (Nt5e)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     58813 (Nt5e)
CD molecules [BR:rno04090]
 Proteins
  58813 (Nt5e)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  58813 (Nt5e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid_C Metallophos
Motif
Other DBs
NCBI-GeneID: 58813
NCBI-ProteinID: NP_067587
RGD: 61956
Ensembl: ENSRNOG00000011071
UniProt: Q66HL0
Position
8q31
AA seq 576 aa AA seqDB search
MRPAAATAPKWLLLALSALLPLWPTAKSWELTILHTNDVHSRLEQTSDDSTKCLNASLCV
GGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNH
EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTS
KETPFLSNPGTNLVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDV
VVGGHTNTFLYTGNPPSKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKG
NVVTSYGNPILLNSTIREDAAIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFREC
NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFG
GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDISRKPWDRVVQLKVLCTK
CRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVI
YPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcccgcggctgctacggcacccaagtggctgcttctcgcgctaagcgctctacta
ccactgtggcccacagccaaatcctgggagctcacgatcctgcacacaaacgacgtgcac
agccggctagagcaaaccagcgatgactccaccaagtgcctcaacgcaagcctgtgtgtg
ggcggcgtggcccggctcttcaccaaggtgcagcagatccgcaaggaagaacccaacgta
ctgcttttggatgctggcgatcagtaccagggcaccatctggttcactgtttacaaaggc
ctggaagtggcacacttcatgaacctcctgggctacgatgccatggcactgggaaatcat
gaatttgataacggtgtggaaggactgattgatcccctcctcagaaatgtcaaatttcca
attctgagtgcaaatattaaggcccgggggccactagcacctcagatatccggactttat
ttgccatataaagttctctctgtcggtggtgaggttgtggggattgttggatatacttca
aaggaaacccccttcctctcaaatccagggacaaatttagtcttcgaagatgaagtcact
gcgttgcagcctgaagtggataaactaaaaactctaaacgtgaacaagatcattgccctg
ggacactctggtttcgagatggataaactcattgcccagaaggtgagaggcgtggacgtc
gtggtgggaggacacaccaacacctttctctacacaggaaatccaccttccaaagaagtg
cctgctgggaagtacccattcatagtcacctctgacgatgggcgaaaggttcccgtggtc
caggcctatgcctttggcaaatacctgggctatctgaaggttgagtttgatgataaagga
aatgttgtcacttcctatggaaatcccattcttctgaacagcaccattcgtgaagatgca
gccatcaaagcagacattaaccagtggaggataaaattagataattattctacacaggaa
ctcgggagaaccatcgtctacctgaatggctccgctcaggagtgccgcttcagagagtgc
aacatgggaaacctgatctgtgatgccatgattaacaacaacctcagacacccagatgaa
atgttttggaaccacgtgtccatgtgcattgtaaatggaggtggcatccggtcccccatt
gatgagaggaacaatggtaccatcacctgggagaacctggctgctgtgctgccctttgga
gggacatttgaccttgtccaattgaaagggtccaccctgaagaaggcttttgagcacagt
gtgcatcgatatggccagtccacaggggagttcctgcaagtgggtggaatccatgtggtg
tatgatatttcccgaaagccctgggacagagtggtccaattaaaagttctctgcaccaag
tgtcgagtgcccatctatgagcctctcgaaatggataaagtgtataaagtggtcctccca
agctatctggtcaacggtggggatggattccaaatgataaaagatgaattattaaaacat
gactctggtgaccaagatatcagtgtggtttctgaatacatctcaaaaatgaaagtaatt
tacccagcagttgaaggacggatcaagttctctgcagcaagtcattaccaaggaagcttt
cctttaataattctttccttttgggcagtgatccttgttttgtaccaataa

DBGET integrated database retrieval system