KEGG   Rattus norvegicus (rat): 58823Help
Entry
58823             CDS       T01003                                 

Gene name
Nckap1
Definition
(RefSeq) NCK-associated protein 1
  KO
K05750  NCK-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    58823 (Nckap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nckap1
Motif
Other DBs
NCBI-GeneID: 58823
NCBI-ProteinID: NP_113806
RGD: 61939
Ensembl: ENSRNOG00000007518
UniProt: P55161 Q562B3 Q32PY0
Position
3q24
AA seq 1128 aa AA seqDB search
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCDLLNTIDVCQVF
FDITVNFDLTKNYLDLTVTYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYEHPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGMLNTEATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLSLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMAVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctccgtgctgcagcccagtcagcagaagctggcggagaagctcaccatcctc
aacgaccggggcgtcggcatgctcacgcgcctctacaacatcaagaaggcatgtggagat
cccaaggctaaaccatcctaccttattgacaaaaacctggaatctgctgtgaaattcata
gtcagaaaatttcctgctgtagaaacacgcaacaacaatcaacagcttgcacaactacag
aaagaaaaatcagagattctgaaaaatctggcattatattactttacatttgtagatgtt
atggaatttaaggaccatgtctgtgacttgctgaatactatcgacgtctgccaagtcttc
tttgatattactgtgaactttgatttaacaaagaactacttagacttgactgtgacctac
acaacattaatgatactgctgtcccggattgaagaaaggaaggccatcattggactgtac
aattatgcacatgaaatgacccacggagcaagtgaccgagaatacccacgccttggtcag
atgattgtggactatgaacaccctttaaagaagatgatggaagaattcgtaccccacagc
aagtctctttcagatgcgctaatttctcttcagatggtgtatcctagacggaatctttca
gcagatcagtggaggaatgcccagttgttgagtctcatcagtgcacccagtacaatgctt
aatcctgcacagtctgacaccatgccttgtgaatatctctctttggatgcaatggagaaa
tggattatctttggctttattctgtgccatgggatgctaaataccgaggctacagcactg
aacctttggaagctagctcttcagagtagctcctgcctctctctctttcgggatgaagtt
ttccacattcacaaagctgcagaagatttatttgtaaacattcggggctataataaacgg
attaacgacataagagaatgtaaggaggcggctgtatcccacgctggctcaatgcacaga
gagagacgcaagtttttacggtctgcactgaaagaactggcaactgtcctctcggatcag
cctggcctgcttggtcccaaggcactttttgttttcatggcattatcttttgcccgtgat
gaaattatctggctactccgtcatgcagacaacatgccaaagaagagtgcagatgacttt
atagataagcacattgctgagctgatcttttacatggaggagctcagagcacatgtcagg
aagtacgggcctgtcatgcagaggtactacgtgcagtacctctccggcttcgatgctgtt
gtccttaacgagcttgtgcagaatctctctgtttgccctgaagatgaatcaatcatcatg
tcctcctttgttaacaccatgacttccctaagtgtgaaacaagttgaagatggggaagtg
tttgatttcagaggaatgagattagattggtttaggttacaggcatacactagtgtctcc
aaagcttcacttagccttgcagatcaccgagaactcggaaagatgatgaacacaataata
ttccatacaaagatggtcgattccttggtggaaatgttggtggaaacatccgatctctcc
atattttgtttttatagccgtgcttttgagaagatgtttcagcagtgcttggagttgcct
tctcagtcgcgatactccatcgcctttcctctgctctgcactcacttcatgagctgcaca
catgagctgtgtcccgaagagcgccatcatataggggatcgtagcctttccctgtgtaat
atgttcctcgatgagatggccaaacaagctcggaacctcatcactgatatttgcacagaa
cagtgtactcttagtgaccagttactgccgaagcattgtgccaaaaccatcagtcaagca
gtgaataagaagtcaaaaaaacagactggcaagaaaggggaacctgaaagggaaaagccg
ggtgtcgagagcatgaggaaaaacaggctggtagtgaccaaccttgataagttgcacact
gcactttcggagttatgcttctccataaattatgttccaaacatggcagtgtgggaacac
accttcacaccgcgggagtacttgacttctcatctggaaatccgattcactaaatcaatt
gttggaatgaccatgtataatcaggctacacaggagattgcaaagccatcagaacttctg
acaagcgtaagagcatatatgactgtactccagtccatagagaactacgtgcagattgat
atcaccagagtatttaataatgttctccttcaacaaacacaacacttagacagccatgga
gaaccaaccatcacaagcctgtatacaaattggtacttggaaacgttattaagacaagtc
agcaatggccatatagcttattttcctgcaatgaaagcatttgtgaatttacccacagaa
aatgaattaacattcaatgcagaggaatactctgatatatcagaaatgaggtcgttgtca
gagctcttaggcccatatgggatgaagttcctaagcgagagtcttatgtggcatatttca
tcacaagttgctgaacttaagaaacttgtggtggagaatgttgatgttctaacacaaatg
aggaccagctttgacaaaccagaccagatggctgcactctttaaaagattatcatctgtt
gacagtgtcttgaaaaggatgacgataattggtgttattttatccttccggtcactggca
caagaagcactgagagatgttttgtcctaccacattccttttctcgtgagctccattgag
gatttcaaggaccacattccacgggaaaccgatatgaaggttgcaatgaatgtgtatgag
ctgtcatctgctgctggattaccatgcgagattgatcctgccttagtagtagctctttcc
tcacaaaaatcagagaacattagtccagaagaagaatataagatcgcttgcctcctgatg
gtctttgtagcagtttccctgcctacactggccagcaatgtgatgtcccagtacagccct
gcaatagaaggacactgcaacaatattcattgtctggccaaagccatcaaccaaattgct
gctgctttgtttacaattcacaaaggaagcattgaagacagacttaaagaattcctggcg
cttgcgtcctccagtctactgaaaatcggccaagagacagataaaactacaacgagaaat
agagaatctgtttatttgctactggatatgattgtacaagaatcaccgttcctgacaatg
gatctcttggaatcttgttttccttatgtgttgctgagaaatgcataccacgctgtctac
aaacaaagtgtcacatcctctgcatag

DBGET integrated database retrieval system