KEGG   Rattus norvegicus (rat): 58826
Entry
58826             CDS       T01003                                 

Gene name
Prg2
Definition
(RefSeq) proteoglycan 2
  KO
K10786  bone marrow proteoglycan
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05310  Asthma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    58826 (Prg2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    58826 (Prg2)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I63
   58826 (Prg2)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 58826
NCBI-ProteinID: NP_113807
RGD: 69336
Ensembl: ENSRNOG00000008394
UniProt: Q63189 G3V729
Position
3q24
AA seq 227 aa
MKFPLLLALLVGGAFALHLSSEASDSKSPLVDESLPREAEISRPEVEECPPGEQLMSLEE
EEEEEEEEGSGSEGALGNEGAVSGQDVTDENLQCPKEEDTTSLMGDSGFKTGRYLLVRRP
ECFNKAQLVCRSCYRGTLASIHSFSVNFRIQSFVRGINQGQVWIGGRIVGWGRCKRFRWI
DGSSWNFAYWAAGQPRRGGGRCVTLCTRGGHWRRSGCGKRRPFICAY
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaaattccctctacttctggctcttctagtcgggggagcatttgctcttcatctaagc
tctgaagcttctgactccaaaagcccactggtggatgagagcttgcctcgggaagcagag
atatcaagaccggaagtagaagaatgccctcctggggaacagctaatgtccctggaggag
gaggaggaggaagaggaggaagaaggttctggaagtgaaggtgctcttggaaatgaagga
gctgtctcaggtcaggatgtgacagatgagaaccttcagtgccccaaggaggaagacaca
acgagtctgatgggtgactctggattcaagaccggtcgctacctcctagtcaggaggcct
gagtgctttaacaaagctcagttggtctgccggagctgctaccggggcacccttgcctcc
atccacagtttcagtgttaacttccgaatccagtcctttgtcaggggaatcaaccagggt
caagtctggattggaggcaggattgtgggctggggtcgctgcaaacgcttccgatggatt
gatggaagctcttggaattttgcatactgggctgctgggcagcctcgtcgcggcggtggc
agatgtgtgaccctgtgtacccgaggaggccactggcgccgatctggctgtggcaagaga
cgccccttcatctgtgcatattaa

DBGET integrated database retrieval system