KEGG   Rattus norvegicus (rat): 58827Help
Entry
58827             CDS       T01003                                 

Gene name
Mest
Definition
(RefSeq) mesoderm specific transcript
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 DUF1057 Hydrolase_4 REV
Motif
Other DBs
NCBI-GeneID: 58827
NCBI-ProteinID: NP_001009617
RGD: 1594589
UniProt: Q6P5P5
Position
4q22
AA seq 335 aa AA seqDB search
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFFTYKGLRIFYQ
DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHQYSI
FEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI
FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAGIR
NNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPINPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgccgagatcgcttgcgcaggatgagggagtggtgggtccaagtagggctcctg
gctgtgcccttgctggctgcgtacctgcacatcccaccccctcagctctcccctgctctg
cactcatggaagacttctggcaagtttttcacctacaagggactacgcatcttctaccaa
gattctgtcggcgtggtgggaagccctgagatagttgtgcttttacatggctttccgaca
tccagctatgactggtacaagatctgggaagggctgaccctgaggttccatcgagtgatt
gccctggatttcttaggctttggcttcagtgacaagccgagaccacatcagtattccata
tttgagcaggccagcatcgtagagtcccttctgcggcacctggggctccagaaccgcaga
atcaacctactgtctcacgactatggggatattgttgctcaggagctgctgtacaggtac
aagcagaatcgttctggccgtctcaccataaagagtctctgtctgtcgaatggaggtatc
tttcctgagacccatcgtcctctccttctccaaaagctcctcaaagacggaggtgtgctt
tcacccatcctcaccaggctcatgaacttctttgtgttctctcgaggtctcactccagtc
tttggaccatatactcgacccactgagagtgagctgtgggacatgtgggctgggattcgc
aacaatgacgggaacctggtcattgacagtcttttacagtacatcaatcaaaggaagaaa
tttagaagacgctgggtgggagcacttgcttctgtgaccatccccattcattttatctat
gggccattggatcctataaatccgtatccagagtttttggagctgtacaggaaaacgctg
ccgcggtccacagtgtcgattctggatgaccacattagccactacccacagctagaggat
cccatgggcttcttgaatgcatatatgggcttcatcaactccttctga

DBGET integrated database retrieval system