KEGG   Rattus norvegicus (rat): 58844Help
Entry
58844             CDS       T01003                                 

Gene name
Grb14
Definition
(RefSeq) growth factor receptor bound protein 14
  KO
K23696   
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: BPS SH2 RA PH
Motif
Other DBs
NCBI-GeneID: 58844
NCBI-ProteinID: NP_113811
RGD: 61869
Ensembl: ENSRNOG00000052498
UniProt: O88900
Position
3q21
AA seq 538 aa AA seqDB search
MTTSLQDGQSAAGRAGAQDSPLAVQVCRVAQGKGDAQDPAQVPGLHALSPASDATRRGAM
DRRKAKDLEVQETPSIPNPFPELCCSPLTSVLSAGLFPRSNSRKKQVIKVYSEDETSRAL
EVPSDVTARDVCQLLILKNHYVDDNSWTLFEHLSHTGVERTVEDHELLTEVLSHWVMEED
NKLYLRKNYAKYEFFKNPMYFFPEHMVSFATEMNGDRSLTQIPQVFLSSNTYPEIHGFLH
AKEQGKKSWKKAYFFLRRSGLYFSTKGTSKEPRHLQFFSEFSTSNVYMSLAGKKKHGAPT
PYGFCFKPTKAGGPRDLKMLCAEEDQSRMCWVTAIRLLKYGMQLYQNYMHPSQARSACSS
QSVSPMRSVSENSLVAMDFSGQKTRVIDNPTEALSVAVEEGLAWRKKGCLRLGNHGSPTA
PSQSSAVNMALHRSQPWFHHRISRDEAQQLITRQGPVDGVFLVRDSQSNPRTFVLSMSHG
QKIKHFQIIPVEDDGEVFHTLDDGHTKFTDLIQLVEFYQLNKGVLPCKLKHYCARMAV
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgtccctgcaagatgggcagagcgccgcgggccgggcgggcgcccaggactcc
ccgctggcagtgcaggtgtgccgcgttgcccagggcaagggagacgcccaggacccggct
caggtccccggactgcacgcgctgtccccggcctcagatgcgacccgccgcggtgccatg
gacaggagaaaagcgaaagatctggaagttcaggaaacgccttccattcctaaccccttc
cctgagctctgctgttctccacttacatcggtgctgtcagcaggcctcttccccagatca
aattcaaggaagaaacaggtgattaaagtttacagcgaggatgagaccagcagagcgtta
gaggtgcccagtgacgtcacagcccgtgatgtctgccagctgttgatcctgaagaaccac
tatgtcgacgacaatagctggaccctttttgagcacctgtctcacacaggcgtagaaagg
acagtggaggaccatgagctgctgactgaagtgctgtctcattgggtgatggaagaagat
aataagctgtatcttagaaagaattatgccaaatatgaattttttaagaacccaatgtat
ttctttccagagcacatggtgtcttttgcaactgaaatgaacggtgacagatcccttaca
cagatcccgcaggtgtttttaagctcaaacacatatcctgaaatccatggcttcctgcat
gcaaaggaacaggggaagaagtcttggaaaaaagcttacttttttctcagaagatctggt
ttatatttttctactaaaggcacatccaaggaaccacggcacttgcagtttttcagtgaa
ttcagcactagtaatgtttacatgtcactggcaggcaaaaaaaagcatggagcgccgact
ccctatggattctgctttaagcctaccaaagcaggagggccccgggacctgaaaatgctg
tgtgcagaagaagaccaaagcaggatgtgctgggtgaccgccattagattgctcaagtat
ggcatgcagctctaccagaattatatgcatccatcccaagctagaagcgcctgcagttct
cagagcgtatcacccatgagaagcgtatcagagaattccctagtagcaatggacttctca
ggtcagaagaccagagtcatagacaaccccactgaagccctttcggttgccgttgaggaa
ggactcgcttggaggaaaaaaggatgtttacgcctggggaatcatgggagtcccactgcg
ccctctcagagctctgctgtgaacatggctctccaccggtcccagccatggtttcaccac
agaatttctagagatgaagctcagcagttgattacccggcaggggcctgtggatggagtt
ttcttggtacgggatagtcagagtaaccccagaacttttgtactgtcaatgagtcacgga
caaaagataaaacactttcaaattatacccgtggaagatgatggtgaggtgttccacacc
ctggatgatggccatacgaagttcacagatctcatccagctcgtggagttctaccagctc
aacaagggggtccttccttgcaagctgaagcattactgtgctaggatggctgtttag

DBGET integrated database retrieval system