KEGG   Rattus norvegicus (rat): 58850
Entry
58850             CDS       T01003                                 

Gene name
Nr0b1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    58850 (Nr0b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    58850 (Nr0b1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    58850 (Nr0b1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    58850 (Nr0b1)
Nuclear receptors [BR:rno03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   58850 (Nr0b1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 58850
NCBI-ProteinID: NP_445769
RGD: 62028
Ensembl: ENSRNOG00000003765
Vega: OTTRNOG00000000297
UniProt: P70503
Position
X
AA seq 472 aa
MAGEDHPWQGSILYNLLMSAKQKHGSREEREVRLGAQCWGCACGTQPVLGGEGLPGGQAL
SLLYRCCFCGENHPRQGGILYSMLTNARQPSGATEAPRARFRAPCWGCACSSAEPLVGRE
GLPAGQVPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREVPEAHRGGEWWQLSYCT
QSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQSSVASDTPVRADQTPAAPQEQPRAPWWDA
SSGVQRPIALKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLE
LAQDHLHFEMMEISEPNLMHEMLTTRRQETEGPEPADPQATEQPQTVSAEAGHVLSVAAV
QAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIESLQWRTQQILTEHIRLM
QREYQIRSAELNSALFLLRFINTDVVTELFFRPIIGAVSMDDMMLEMLCAKL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgggtgaggaccacccgtggcagggcagcatcctctacaatctgttgatgagcgcg
aagcagaagcacgggtctagggaagagcgagaggtgcgcttgggggctcagtgctggggt
tgcgcctgcggtactcagcccgtcctgggtggggagggactgcccggcgggcaagccttg
tcccttctgtaccgctgctgcttttgtggggagaaccacccgcgccagggtggcatcctc
tactctatgctcaccaacgccaggcagcctagcggggcgaccgaggcgcccagggcgcga
ttcagagctccttgctggggctgcgcctgcagcagcgcagagcccctggtgggcagagag
gggctgccagctggccaggtcccctcgctcctgtaccgctgctgcttctgcggagaagag
cacccgaggcagggcagcatcttatacagcttgctcactagtgcccagcaaacgcacgtg
tctcgggaagtacccgaggcacatcgcggaggcgagtggtggcagctgtcctactgtacc
cagagtgtgggtggcccggaggggcttcagagcacacaggccatggcgttcctgtaccgt
agctatgtgtgcggtgaagagcagccccagcagagcagcgttgcctccgacacgcccgtg
agagcagatcaaacaccagcagctccgcaagagcagccgagggccccctggtgggacgcc
tcctctggtgtgcagcgtccgattgcactcaaggatccacaggtggtgtgcgaggcagcg
tcggctggcctattgaagaccctgcgctttgtcaagtacttgccttgcttccagatcctg
cccttagatcagcagctggtgctggtgcggagctgttgggcgcccctactcatgcttgag
ttggcccaagatcacctgcacttcgagatgatggagatttccgagcccaacctgatgcac
gaaatgctcaccaccaggcggcaggagaccgaaggcccagagcccgcagatccccaggcc
acagagcagccacagacggtgtctgcggaggctgggcacgtgctctcagtcgctgcggtc
caggccatcaagagtttcttttttaagtgctggagtctgaacattgacaccaaagagtac
gcctatctgaaggggaccgtgctttttaacccagacctgcctggcctgcagtgcgtgaaa
tacatcgagagtcttcagtggagaactcagcagatcctcactgagcacatcaggctgatg
caaagagagtaccagatcagatcggctgaactgaatagtgcccttttcctgctgagattc
atcaacaccgatgttgtcactgaactctttttcaggcccatcattggtgccgtcagcatg
gatgatatgatgctggagatgctctgtgcaaagctgtga

DBGET integrated database retrieval system