KEGG   Rattus norvegicus (rat): 58920Help
Entry
58920             CDS       T01003                                 

Gene name
Gpc1, HSPG_M12, HSPGM12
Definition
(RefSeq) glypican 1
  KO
K08107  glypican 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    58920 (Gpc1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    58920 (Gpc1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    58920 (Gpc1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    58920 (Gpc1)
Proteoglycans [BR:rno00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   58920 (Gpc1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Others
  58920 (Gpc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican
Motif
Other DBs
NCBI-GeneID: 58920
NCBI-ProteinID: NP_110455
RGD: 61853
Ensembl: ENSRNOG00000049437
UniProt: P35053
Position
9q36
AA seq 558 aa AA seqDB search
MELRARGWWLLCAAAALVACTRGDPASKSRSCSEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANHSRMELETALHDSSRALQATLATQLHGIDDHFQRLLNDSER
TLQDAFPGAFGDLYTQNTRAFRDLYAELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLLPDDYLDCLGKQAEALRPFGDAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV
PLAPECSRAVMKLVYCAHCRGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
TDKFWGPSGAEYVIGSVHMWLAEAINALQDNKDTLTAKVIQGCGNPKVNPHGSGPEEKRR
RAKLALQEKSSTGTLEKLVSEAKAQLRDIQDYWISLPGTLCSEKMAMSPASDDRCWNGIS
KGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRGAYGGNDVDFQD
ASDDGSGSGSGGGCPDDACGRRVSKKSSSSRTPLIHALPGLSEQEGQKTSAATRPEPHYF
FLLFLFTLVLAAARPRWR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggcccgaggctggtggctgctgtgcgcggccgccgcgctagtcgcctgc
acccgcggggaccccgccagcaagagccggagctgcagcgaagtccgccagatctacggg
gctaagggctttagcctgagcgacgtgccccaggcagagatctcgggagagcacctgcgg
atctgcccccagggctacacctgctgcaccagtgagatggaggagaacctggccaaccac
agccggatggagctggagaccgcactccacgacagcagccgtgccctgcaggctacactg
gccacccagctgcatggtatcgatgaccacttccagcgcctgctgaatgactcggagcgt
acactgcaggatgcttttcccggggcctttggggacctgtacacgcagaacactcgggcc
ttccgggacctgtatgctgagctgcgtctctactaccgaggggccaacctacaccttgag
gagacactggccgagttctgggcacggctgctggagcgtctcttcaagcagctgcacccc
cagctgctgctgcccgatgactatctggactgcctgggcaagcaggcggaggcactgcgg
ccgtttggggatgcccctcgagaactgcgcctgagggccacccgtgcttttgtggcggca
cgatcctttgtgcagggcctgggtgtggccagtgacgtagtccgaaaggtggcccaggtt
cctctggccccagaatgttctcgggctgtcatgaagttggtctactgtgcccattgccgg
ggagtccctggtgcccggccctgtcccgactattgccgaaatgtgctcaaaggctgcctt
gccaaccaggccgacctggatgccgagtggaggaacctcctggactccatggtgctcatc
actgacaagttctggggcccgtcgggtgcggagtatgtcattggcagtgtgcatatgtgg
ctggcggaggccatcaacgccctccaggacaacaaggacacactcacagctaaggtcatc
cagggctgcggaaaccccaaggtcaatccccatggctctgggcctgaggagaagcgtcgc
cgtgccaaactggcactgcaggagaagtcctccacaggtactctggaaaagctggtctct
gaggccaaggcccagctccgagacattcaggactactggatcagcctcccagggacactg
tgtagtgagaagatggccatgagtcctgccagcgatgaccgctgctggaatgggatttcc
aagggccggtacctacctgaggtgatgggtgatgggctggccaaccagatcaacaaccct
gaagtggaggtggacatcaccaagccggatatgaccatccggcagcagatcatgcagctc
aagatcatgaccaaccgtttacgtggcgcctacggtggaaatgatgtggacttccaggat
gccagtgatgacggtagtggttccggcagcggtggcggatgcccagatgacgcctgtggt
cggagggtcagcaagaagagctccagctcccggacccccttgatccatgccctccccggc
ttgtcagaacaggagggacagaagacctcggccgccactcgcccagagcctcactacttc
tttctgctcttcctgttcaccttggtccttgctgcagccaggcccaggtggcggtaa

DBGET integrated database retrieval system