KEGG   Rattus norvegicus (rat): 58921
Entry
58921             CDS       T01003                                 

Gene name
Foxm1
Definition
(RefSeq) forkhead box protein M1
  KO
K09406  forkhead box protein M
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    58921 (Foxm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    58921 (Foxm1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    58921 (Foxm1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 58921
NCBI-ProteinID: NP_113821
RGD: 61807
Ensembl: ENSRNOG00000005936
UniProt: D3ZLE1
Position
4
AA seq 771 aa
MRTSPRRPLILKRRRLPLPIQNAPSETSEEEAKRSPGQQEPTQAQASQDVAESSSCKFPA
GIKIINHPTMPNTQVVAIPNNADIQSIITALTAKGKESGSSGPNKFILISSGGASSHPPD
PQSQAQTSTDSKRTELITETLGPKPGAKGVPVPKPPGALPRQRQESCGGEAAGCTLDNSL
TNIQWLGKMSSDGLGRCSIKQELEEKENCHLEQNRVKVEAPSRASVSWQDSVSERPPYSY
MAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKCWHQAYHKLGPQNSIRHNL
SLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPLEPGSPQSPEHLESQQKRPNPEL
RRNVTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSE
LARHSKRVRIAPKVLLSNEGIAPLPATEPMKEEKPLLGEGLLPLLPIQSIKEEVIQPGED
IPHLERPIKVESPPLEEWPSPCASVKEELSNSWEDSSCSPTPKPKKSYCGLKSPTRCVSE
MLVTKRREKREVSRSRRKQHLQPPCLDEPELFFSEDSSTFRPAMEILAESSEPAPQLSCP
QEEGGPFKTPIKETLPVSSTPSKSVLSRDPESWRLTPPAKVGGLDFSPVRTPQGAFGPLP
DSLGLMELNTTPLKSVPLFDSPRELLNSEAFDLASDPFSSSPPPHLEAKPGSPELQVPSL
SANRSLTEGLVLDTMNDSLSKILLDISFPGLEEDPLGPDNINWSQFIPELR
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgagaaccagcccccggcggccactgattctcaagagacggaggctgccccttcctatt
caaaatgccccgagtgaaacctcagaggaagaagcaaagagatcccctggacagcaggag
cctactcaagcacaggcctcccaagatgtggcagagtccagctcttgcaaatttccagct
ggaatcaagattatcaaccacccaaccatgcccaacacacaagtggtggctatccccaac
aacgcggacatccagagcatcatcacagcgctgactgccaaagggaaagagagtggcagc
agtgggcccaacaagttcatcctcatcagctctggtggggcctcatctcatcctcctgat
cctcaatctcaagcccaaaccagcactgattccaagagaacagaactgatcaccgagacg
ttgggaccaaagccaggggctaagggtgtgcctgttcccaagccacctggagctcttcca
aggcaaagacaggagagctgtggtggtgaagcggccggctgcacactggacaacagctta
accaatatccagtggcttggaaagatgagttctgatgggctgggccgctgcagcattaag
caggaactggaagagaaggagaattgtcacctggagcagaatcgggttaaggttgaggcg
ccctcaagagcatcagtgtcttggcaggactctgtgtctgagaggccaccctactcctat
atggccatgatacagttcgcgatcaacagcactgagaggaagcgtatgaccttgaaggat
atctacacttggatcgaggaccacttcccttattttaagcacattgccaagccaggctgg
aagtgttggcaccaggcctaccacaagctcgggccacagaactctattcgtcacaacctt
tctctccatgacatgtttgttcgagaaacatctgccaatggcaaggtctccttctggacc
attcacccaagtgctaatcgctacttgacattggaccaagtgtttaagccactggaacca
gggtctccacaatcgcccgagcacttggaatcacagcagaaacgacccaatcctgagctc
cgtagaaatgtgaccatcaaaactgaactcccactaggcgcacggcgaaagatgaagcca
ctgctcccacgggttagctcatacctggtgcccatccagttcccggtgaaccagtccctg
gtgttacagccctcggtgaaggttcccttgcctctggcagcatctcttatgagctcagag
cttgcccgtcatagcaagcgagtccgcattgcacccaaggtgctgctatccaacgaaggg
atagccccacttcctgccacagaacccatgaaggaggagaaacccctgcttggagaaggg
ctattgcctttgcttcctattcagtccattaaggaagaagtaattcagcctggggaggac
ataccacacttagagaggcctatcaaagtggagagccctcccttggaagagtggccctct
ccgtgtgcatcagtgaaagaggaactgtccaactcctgggaagattcttcctgctctcct
accccaaagcccaagaagtcctattgtgggcttaagtccccaacacggtgtgtctcagaa
atgctggtgacaaagcggagagagaagagagaggtgagccgatctcggaggaagcagcac
cttcagccaccctgtctagatgagcctgaactcttcttctcagaggactccagcacattt
cggccagccatggagatcctggcagagtcttcagagcctgcaccacagctcagctgccct
caggaggagggagggcccttcaagacccccatcaaggagacattgcctgtctcctccact
cctagcaagtctgtgctctctagagaccctgagtcctggaggctcacacccccagccaaa
gttggggggttagatttcagcccagtacgaaccccccagggtgcctttggccctctgcct
gactcgctggggcttatggagctgaataccacacctctgaaaagtgttcccctcttcgac
tcaccccgggagctccttaactcagaagcctttgaccttgcctctgatccctttagcagt
tctccaccaccacatttggaagccaagccaggctcccccgagctgcaggtccccagcctt
tcagccaaccgttctctcacagaaggccttgtcctggacacaatgaatgatagcctcagc
aagatccttctagacatcagtttccctggcctggaggaggaccctctgggccctgacaac
atcaactggtctcagttcatccctgagctgcgatag

DBGET integrated database retrieval system