KEGG   Rattus norvegicus (rat): 58923
Entry
58923             CDS       T01003                                 

Gene name
Mefv, pyrin
Definition
(RefSeq) Mediterranean fever
  KO
K12803  pyrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    58923 (Mefv)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    58923 (Mefv)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    58923 (Mefv)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    58923 (Mefv)
SSDB
Motif
Pfam: PYRIN zf-B_box SpoVR
Other DBs
NCBI-GeneID: 58923
NCBI-ProteinID: NP_113822
RGD: 61889
Ensembl: ENSRNOG00000008134
UniProt: Q9JJ25
Position
10q12
AA seq 750 aa
MANTRVDHLLNTLEELLPYELEKFKFKLHTTSLEKGHSRIPLSLVKMARPIKLTRLLLTY
YGEEYAVRLTLQILRATNQRQLAEELHKATGPEHLTEENGVGGSVQSSAENKDKGVKGSD
VLGEDEAQQNDDESDILPPIQAEVGKGPQKKSLAKRKDQRGPESLDSQTKPGARSAAPLY
RRTLVTQSPGDKENRAGAQTPQNAQLCREAARNSTAMSQGGERSRRLKCICLQERSDPGV
LKLPLTQKKENPQIQKLFRLKRKQEMAVSFVRETATLNGRTTGTLEKGVGIPEHSMMLDE
ETSRNMSSKISLTREKRCTASWTENGNGGPETPETLGETVSSILCDSCSPKVLLSLGEKL
AQTPEDPASLGQAASKGRSRDKVACPLCHTQGELPAKACVQSSCSCSVAPGDPKASGRCS
ICFQCQSSRAGKSCEAQSPQFLPQCPRHMKQVQLLFCEDHREPICLICRLSQEHQGHRVR
PIEEAALQYKEQIRKQLERLREMRGYVEEHKLPADKKAEDFLKQTETQKQRISCPLEKLF
QFLEQQEQLFVTWLQELVQTIGKVRETYYTQVSLLDKLIGELEAKQDQPEWELMQDIGAT
LHRAETMTASELLGIPPGVKEKLHLLYQKSKSAEKNMQRFSEMLGSEMAFSASDVATREG
CRPSTTKAQALIPTVHLKCDGAHTQDFDVILCAELEAGGSEPQDYLHPSSAQDTPELHEI
HSQNNKRKFKSFLKWKPSFSRTDRCLRTCW
NT seq 2253 nt   +upstreamnt  +downstreamnt
atggccaatacccgtgttgaccatctgctaaacaccctggaggagctgctgccctatgaa
ctagagaaattcaagtttaagttgcacaccaccagcctggagaagggccactctaggatc
cccctgagcctcgtgaagatggccaggccaataaagctgaccagactcctgctaacctac
tatggggaagaatatgctgtaaggctgaccctgcagatcctgcgggccaccaaccagcgc
caactagcagaggagcttcacaaggccacaggcccagaacatttgactgaagaaaatgga
gttggcggttctgtgcagtcttctgcagagaataaggacaagggtgtgaagggatcagat
gtccttggagaggatgaggcacagcagaacgatgatgaatcagacatcctgccacccatc
caggcagaagtggggaaggggccccagaagaaatcactggccaaaaggaaggatcagagg
ggccctgagagcctggactcacagaccaagccaggggccaggagtgcagcaccactctat
aggagaaccctggtgacccagtccccaggggacaaggagaacagagcgggtgctcagact
ccgcagaatgcccagctctgcagggaggctgcaaggaactctacagcaatgtcccaggga
ggagagagatcaagaaggctgaagtgtatttgccttcaggaaagaagcgacccaggagtc
ttgaaattaccacttactcaaaagaaggagaacccccaaattcagaagctcttccgactc
aagaggaaacaagaaatggcagtctcattcgtacgagaaacagccaccctgaatggaagg
actacggggactctggaaaagggtgtagggattccagaacattccatgatgctggatgaa
gaaacatccagaaacatgtcttccaaaatatcgttgactagggagaagagatgcactgcg
tcatggacagaaaatggaaacgggggtccagaaaccccagagaccttgggagagacagtc
agcagcatactctgtgactcctgcagtccaaaagtgctgctgtcattaggtgaaaaactg
gcccagactccagaagacccagcatctttaggacaggcagcttctaaaggaaggtcacgg
gacaaggttgcatgccctctttgccacacccaaggagaactgcctgctaaggcctgtgtg
caaagttcctgtagctgctcggttgctcctggggaccccaaggcctcaggcagatgctcc
atatgcttccagtgccaaagctcgcgtgcaggaaagagctgtgaagcccagagcccccag
ttcctaccacagtgcccacgtcacatgaagcaggtgcagctgcttttctgtgaggaccac
agggagcccatctgcctcatctgcaggctgagccaggagcatcaaggacatcgagtgcgc
cccatagaggaggctgcactacagtacaaggagcagatccggaagcagttggagcgcctg
cgngagatgaggggatatgtggaggagcacaagcttccggcagacaagaaagcagaggac
ttcctgaaacaaacagaaactcagaaacagaggatatcatgtccgcttgagaagctattc
caattcctggagcagcaagagcaactctttgtgacctggctgcaggagctagtccagacc
atcggcaaggtccgagagacatactacacccaggtttccctactggataagctgattgga
gaactagaggccaagcaagaccagccagagtgggagctcatgcaggacattggagccacc
ttgcacagggctgagacgatgactgcctctgagctgttgggcattcctccaggcgttaaa
gaaaaactgcacctgctctaccagaaatcaaagtccgccgagaagaatatgcagcgtttc
tcagaaatgctgggctccgaaatggcattcagcgcttcagatgtagcaacacgggaaggg
tgcaggcctagcacaaccaaggcccaggccttgatccccaccgttcacctaaagtgtgat
ggtgcacacacacaggatttcgatgtaatactttgcgcagagctggaagctggaggatca
gaacctcaagattaccttcatccatcgtcagctcaagacacacctgagctacacgagatc
cattctcagaacaacaaaagaaaatttaaatctttcctgaagtggaaaccttccttctcc
agaaccgacaggtgcttaagaacatgctggtaa

DBGET integrated database retrieval system