KEGG   Rattus norvegicus (rat): 58934
Entry
58934             CDS       T01003                                 

Gene name
Pdcd2
Definition
(RefSeq) programmed cell death 2
  KO
K14801  pre-rRNA-processing protein TSR4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    58934 (Pdcd2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    58934 (Pdcd2)
SSDB
Motif
Pfam: PDCD2_C zf-MYND
Other DBs
NCBI-GeneID: 58934
NCBI-ProteinID: NP_113826
RGD: 61887
Ensembl: ENSRNOG00000001490
UniProt: P47816
Position
1q12
AA seq 343 aa
MAAVVPVTVELGFVEEAPAWRLRSEQFPSKVGGRPAWLALAELPGPGALACARCGRPLAF
LLQVYAPLPGRDEAFHRSLFLFCCREPLCCAGLRVFRNQLPRKNAFYSYEPPSETGASDT
ECVCLQLKSGAHLCRVCGCLAPMTCSRCKQAHYCSKEHQTLDWQLGHKQACTQSDHLDHM
VPDHNFLFPEFEIVTETEDEIGPEVVEMEDYSEVIGSMEGVPEEELDSMAKHESKEDHIF
QKFKSKIALEPEQILRYGRGIKPIWISGENIPQEKDIPDCSCGAKRIFEFQVMPQLLNHL
KADRLGTSVDWGILAVFTCAESCSLGIGYTEEFVWKQDVTETP
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggctgccgttgtgccagttacggtggagttgggcttcgttgaggaggcaccggcctgg
aggctgcgcagcgagcagtttccaagcaaagtgggcgggcggcctgcgtggttggccctg
gcggagctgcccggacctggggcgctggcgtgcgcgcgttgcggccgcccgctcgccttc
ctgctgcaagtgtacgcaccgcttccgggtcgggacgaagccttccaccgtagcctcttt
ctcttctgctgtcgagagccgctgtgttgcgccggcctgcgagtttttcgtaatcagcta
ccaaggaaaaatgcattttactcatatgagcccccttctgaaacgggagcttcggataca
gaatgtgtgtgcctccaacttaagtctggagctcatctctgcagggtttgtggttgcttg
gcccctatgacatgctctaggtgcaaacaggcacattactgcagcaaggaacatcagaca
ttagactggcagctcggccacaagcaggcttgtacacagtcagaccatttagaccatatg
gttccagaccataacttcctgtttccagaatttgaaattgtaacagaaacagaagacgag
attgggcctgaggtggtggaaatggaggattactctgaagttataggaagcatggaggga
gtacctgaggaagaactagattccatggcaaagcatgaatccaaggaggatcacatattc
caaaagtttaaatccaaaatagcccttgaaccagagcagattctcaggtatggaagaggt
attaaacccatctggatttctggtgaaaatattcctcaagaaaaagatattccagattgc
tcatgtggtgccaagagaatatttgaattccaggtcatgcctcagctgttgaaccaccta
aaggcagacagactgggtacaagtgtggactggggcatcttggctgtcttcacctgtgct
gagagctgcagcctgggcatcgggtacacagaagaatttgtgtggaaacaggatgtgaca
gagacaccgtga

DBGET integrated database retrieval system