KEGG   Rattus norvegicus (rat): 58945Help
Entry
58945             CDS       T01003                                 

Gene name
Dynll1, 8kDLC, Dlc8, Dnclc1, Pin
Definition
(RefSeq) dynein light chain LC8-type 1
  KO
K10418  dynein light chain LC8-type
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    58945 (Dynll1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    58945 (Dynll1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     58945 (Dynll1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynein_light
Motif
Other DBs
NCBI-GeneID: 58945
NCBI-ProteinID: NP_445771
RGD: 619866
Ensembl: ENSRNOG00000011222
UniProt: P63170
Structure
PDB: 

Position
12q16
AA seq 89 aa AA seqDB search
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgaccggaaggcggtgatcaaaaatgcagacatgtcggaagagatgcaacaggac
tcggtggagtgcgctactcaggcgttggagaagtacaacatagagaaggatatcgcggcc
catatcaagaaggagtttgacaagaagtacaaccccacctggcactgcatcgtgggccgg
aacttcggtagctacgtgacacacgagaccaaacacttcatctacttctacctgggtcag
gtggccattctcctgttcaaatctggttaa

DBGET integrated database retrieval system