KEGG   Rattus norvegicus (rat): 58949Help
Entry
58949             CDS       T01003                                 

Gene name
Ptafr
Definition
(RefSeq) platelet-activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    58949 (Ptafr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    58949 (Ptafr)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    58949 (Ptafr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    58949 (Ptafr)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Platelet activating factor
    58949 (Ptafr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 58949
NCBI-ProteinID: NP_445773
RGD: 61897
Ensembl: ENSRNOG00000013231
UniProt: P46002
Position
5q36
AA seq 341 aa AA seqDB search
MEQNGSFRVDSEFRYTLFPIVYSVIFVLGVVANGYVLWVFATLYPSKKLNEIKIFMVNLT
VADLLFLMTLPLWIVYYSNEGDWIVHKFLCNLAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGITLSLVIWISIAATASYFLATDSTNVVPKKDGSGNITRCFEHYEPY
SVPILVVHIFITSCFFLVFFLIFYCNMVIIHTLLTRPVRQQRKPEVKRRALWMVCTVLAV
FVICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVMMPANQTPVLPLKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaaatggctccttccgtgtggattctgagtttcgatacaccctctttccgatc
gtttacagcgtcatctttgtactgggcgtggttgccaatggctatgtgctgtgggtcttt
gccaccttgtacccgtccaagaaactgaatgagataaagatcttcatggtgaatctcacc
gtggcggacctgctcttcttgatgaccctcccgctgtggattgtctattactccaacgag
ggcgactggattgtacacaaattcctgtgcaacctggctggctgcctcttcttcatcaat
acctactgcagtgtggccttccttggcgtcatcacttataaccgctaccaggcagtagcc
tatcccatcaagaccgcccaggccaccacccgcaagcgtggcatcactttgtccctggtc
atttggatatccatcgcggctactgcatcctacttcctggccacagactctaccaacgtg
gtgcccaaaaaggatggctcaggtaacatcacccgctgctttgagcattatgagccatac
agtgtgcccatccttgtcgtccacatcttcatcacctcctgtttcttcctcgtcttcttc
ctcatcttctactgcaacatggtcatcatccacacgctgctcacgcggcctgtgcggcag
cagcgcaaaccggaagtgaagcgccgggcgctgtggatggtctgcactgtcttggcggta
tttgtcatctgctttgtgccccatcacgtggtccagctaccctggaccctagcagagttg
ggctaccagaccaacttccatcaggctattaatgatgcccaccaaatcaccctctgcctc
ctgagcaccaactgcgtcttagatcctgttatctactgctttctcaccaagaagttccgg
aagcacctcagcgaaaagttttacagcatgcgaagtagccggaagtgctcccgagccact
agcgacacgtgcaccgaggtgatgatgccagccaaccagactcctgtcctgccattgaaa
aattaa

DBGET integrated database retrieval system