KEGG   Rattus norvegicus (rat): 58950
Entry
58950             CDS       T01003                                 

Gene name
Fkbp1b
Definition
(RefSeq) FK506 binding protein 1B
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    58950 (Fkbp1b)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     58950 (Fkbp1b)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    58950 (Fkbp1b)
SSDB
Motif
Pfam: FKBP_C
Other DBs
NCBI-GeneID: 58950
NCBI-ProteinID: NP_073166
RGD: 61835
Ensembl: ENSRNOG00000047143
UniProt: P97534
Position
6q14
AA seq 108 aa
MGVEIETISPGDGRTFPKKGQICVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
NT seq 327 nt   +upstreamnt  +downstreamnt
atgggcgtggagatcgagaccatctccccgggagacggaaggacattccctaagaagggt
cagatatgcgtggtgcactacacagggatgctccagaatggcaagaaattcgattcgtcc
agagacagaaacaaacccttcaagttcagaattggcaagcaggaagtcatcaaaggtttt
gaagaaggcgctgcccagatgagcttggggcagagggcgaagctgacctgcacccctgat
gtggcatatggagctactggccaccccggtgtcatccctcccaatgccaccctcatcttt
gacgtggagctgctcaacttagagtga

DBGET integrated database retrieval system