KEGG   Rattus norvegicus (rat): 58952
Entry
58952             CDS       T01003                                 

Gene name
Cpq, LAL, Pgcp, lal-1
Definition
(RefSeq) carboxypeptidase Q
  KO
K01302  carboxypeptidase Q [EC:3.4.17.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    58952 (Cpq)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-  
     58952 (Cpq)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   58952 (Cpq)
SSDB
Motif
Pfam: Peptidase_M28 Peptidase_M20 4HB_MCP_1
Other DBs
NCBI-GeneID: 58952
NCBI-ProteinID: NP_113828
RGD: 628610
Ensembl: ENSRNOG00000005931
UniProt: Q6IRK9
Position
7q22
AA seq 472 aa
MRFLFFLFVAVVHLFSLGSGKAIYKSGVSQRTFQEIKEEIANYEDVAKAIINLAVYGKYQ
NRSYERLGLLVDTVGPRLSGSKNLEKAIQIMYQNLQQDGLENVHLEQVRIPHWGRGEESA
VMVVPRIHKLAILGLGGSIGTPPEGITAEVLVVASFVELQRRASEARGKIVVYNQPYTDY
GKTVQYRERGAVEAAKVGAVASLIRSVASFSIYSPHTGHQGYQDGVPKIPTACITIEDAE
MMSRMASRGDKIVIHLKMGAKTYPDTDSFNTVAEITGSKYPEEVVLVSGHLDSWDVGQGA
LDDGGGAFISWEALSLVKDLGLRPKRTLRLVLWTAEEQGGVGASQYYELHKANISKYSLV
MEADSGTFLPTGLQFTGSDKARAIMKEVMSLLQPLNITKVFNDAEGTDINFWIQAGVPGA
SLRDDLYKYFFFHHSHGDTMTAMDPKQMNVAAAVWAVVAYVVADMEEMLPRS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaggttccttttcttcctgttcgttgctgttgttcaccttttctccttgggctctgga
aaagctatatacaagagtggtgtttctcagcgaacatttcaagaaataaaagaagaaata
gccaactatgaagatgttgctaaagcaattatcaaccttgctgtttatggaaaataccag
aaccggtcgtatgagcgtttgggacttctagttgatactgttggacccagactgagtggc
tctaagaacctagagaaagctatccaaatcatgtaccaaaacctgcaacaagatgggctg
gaaaacgtccacctggagcaggtcagaatacctcactgggggaggggcgaagaatctgca
gtgatggtggtgcctcgaattcacaagttggctattttaggccttggcggcagcattggg
actcctcctgaaggtatcacagcagaagtactcgtggtggcctcttttgttgaacttcaa
agaagggcatcagaggcaagagggaagattgttgtttataaccagccttacactgactat
gggaaaactgtgcagtaccgggagcgcggagctgtggaagctgccaaggtgggggccgtg
gcatccctcatccgatcagtagcttctttttccatctacagtcctcacacaggtcatcaa
ggatatcaagatggtgtgcccaagattccaacagcctgtatcacaatagaagatgcagaa
atgatgtctcgaatggcttctcgtggggacaaaattgtcattcatctgaaaatgggagca
aagacctatccagatacagattccttcaacactgttgcagagatcactgggagcaagtat
ccagaggaagttgtcctggtcagtggacatctggacagctgggacgtcgggcagggtgca
ctggatgatggcggtggagccttcatatcatgggaagcactctcacttgttaaagatctt
gggctgcgtccaaagaggactctgcgcttggtgctctggaccgcagaagaacaaggaggg
gttggtgcctcccagtattatgagctacataaggcaaatatttccaagtacagtttggtg
atggaggctgactcaggaaccttcttacccactgggctgcagttcaccggcagtgacaag
gccagggctatcatgaaggaagtcatgagtctcctgcaacccctcaatatcaccaaggtc
tttaatgatgcagaaggaactgacattaacttctggatccaagctggagtgcctggagcc
agtctgcgagatgacttgtacaagtatttctttttccatcattcccatggagacaccatg
actgccatggatccaaagcagatgaatgttgctgctgctgtttgggctgttgtcgcttac
gttgtggcagacatggaggaaatgctgcccaggtcctaa

DBGET integrated database retrieval system