KEGG   Rattus norvegicus (rat): 58959Help
Entry
58959             CDS       T01003                                 

Gene name
Crhr1, CRFR1, CRH-R_1
Definition
(RefSeq) corticotropin releasing hormone receptor 1
  KO
K04578  corticotropin releasing hormone receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04730  Long-term depression
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    58959 (Crhr1)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    58959 (Crhr1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    58959 (Crhr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    58959 (Crhr1)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    58959 (Crhr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 58959
NCBI-ProteinID: NP_112261
RGD: 61276
Ensembl: ENSRNOG00000004900
UniProt: P35353
Position
10q32.1
AA seq 415 aa AA seqDB search
MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggacggcgcccgcagctccggctcgtgaaggcccttctccttctggggctgaaccct
gtgtccacctcccttcaggatcagcgctgtgagaacctgtccctgaccagcaatgtttct
ggcctgcagtgcaatgcatccgtggacctcattggcacctgctggccccggagccctgcg
ggccagttggtggtccgaccctgccctgcctttttctacggtgtccgctacaacacgaca
aacaatggctaccgggagtgcctggccaacggcagctgggcagcccgtgtgaattattct
gagtgccaggagattctcaacgaagagaagaagagcaaagtacactaccatgttgcagtc
atcatcaactacctgggtcactgcatctccctggtagccctcctggtggcctttgtcctc
ttcttgcggctcaggagcatccggtgcctgagaaacatcatccactggaacctcatctcg
gctttcatcctacgcaacgccacgtggtttgtggtccagctcaccgtgagccccgaggtg
caccagagcaatgtggcctggtgtaggttggtgacagccgcctacaattacttccatgta
accaacttcttctggatgttcggtgagggctgctacctgcacacagccattgtgctcacg
tactccaccgaccgtctgcgcaagtggatgttcgtctgcattggctggggtgtacctttc
cccatcattgtggcttgggccattgggaagctgcactacgacaatgaaaagtgctggttt
ggcaaacgtcctggggtatacactgactacatctaccagggccccatgatcctggtcctg
ctgatcaactttatctttctcttcaacattgtccgcatcctcatgaccaaactccgggca
tccactacatctgagaccattcagtacaggaaggctgtgaaggccactctggtgctcctg
ccccttctgggcatcacctacatgttgttcttcgtcaaccctggagaggacgaggtctcc
agggtcgtcttcatctacttcaactcttttctggagtcctttcagggcttctttgtgtct
gtgttctactgttttctgaacagtgaggtccgctccgctatccggaagaggtggcgtcgg
tggcaggacaagcactccatcagagcccgagtggcccgagctatgtccatccccacctcc
ccgaccagagtcagctttcacagcatcaagcagtccacagcagtgtga

DBGET integrated database retrieval system