KEGG   Rattus norvegicus (rat): 58965Help
Entry
58965             CDS       T01003                                 

Gene name
Ramp1
Definition
(RefSeq) receptor activity modifying protein 1
  KO
K08447  receptor activity modifying protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    58965 (Ramp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    58965 (Ramp1)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Others
   Receptor activity modifying protein
    58965 (Ramp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAMP
Motif
Other DBs
NCBI-GeneID: 58965
NCBI-ProteinID: NP_113833
RGD: 61870
Ensembl: ENSRNOG00000019926
UniProt: Q9JJ74
Position
9q36
AA seq 148 aa AA seqDB search
MAPGLRGLPRRGLWLLLAHHLFMVTACRDPDYGTLIQELCLSRFKEDMETIGKTLWCDWG
KTIGSYGELTHCTKLVANKIGCFWPNPEVDKFFIAVHHRYFSKCPVSGRALRDPPNSILC
PFIVLPITVTLLMTALVVWRSKRTEGIV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggcccccggcctgcggggcctcccgcggcgcggcctctggctgctgctggctcatcat
ctcttcatggtcactgcctgccgggaccctgactatggtactctcatccaggagctgtgt
ctcagccgcttcaaagaggacatggagaccatagggaagactctgtggtgtgactgggga
aagaccatagggagctatggggagctcactcactgcaccaaactcgtggcaaacaagatt
ggctgtttctggcccaatccggaagtggacaagttcttcattgctgtccaccaccgctac
ttcagcaagtgcccagtctcgggcagggccctgcgggaccctcccaacagcatcctctgc
cctttcattgtgctccccattacggtcacactgctcatgactgccctggtggtctggagg
agcaagcgcacagagggcatcgtgtag

DBGET integrated database retrieval system