KEGG   Rattus norvegicus (rat): 58974
Entry
58974             CDS       T01003                                 

Gene name
Gabarap
Definition
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04136  Autophagy - other
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04371  Apelin signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04727  GABAergic synapse
rno05014  Amyotrophic lateral sclerosis
rno05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    58974 (Gabarap)
   04068 FoxO signaling pathway
    58974 (Gabarap)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    58974 (Gabarap)
   04136 Autophagy - other
    58974 (Gabarap)
   04137 Mitophagy - animal
    58974 (Gabarap)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    58974 (Gabarap)
  09156 Nervous system
   04727 GABAergic synapse
    58974 (Gabarap)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    58974 (Gabarap)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    58974 (Gabarap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    58974 (Gabarap)
   04121 Ubiquitin system [BR:rno04121]
    58974 (Gabarap)
   03029 Mitochondrial biogenesis [BR:rno03029]
    58974 (Gabarap)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    58974 (Gabarap)
Ubiquitin system [BR:rno04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   58974 (Gabarap)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    58974 (Gabarap)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 58974
NCBI-ProteinID: NP_742033
RGD: 61911
Ensembl: ENSRNOG00000017417
UniProt: P60517
Structure
PDB: 
1KJT

Position
10q24
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaggagcatccgttcgagaagcgccgctctgagggcgagaaa
atccgaaagaaatacccagaccgggtcccggtgatagtggaaaaagctcccaaagctcgg
ataggggacctggacaaaaagaaatacttggtgccttctgatcttacagttggtcaattc
tacttcttgatccggaagcgaattcatctccgtgctgaagatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagcgtctacggtctgtga

DBGET integrated database retrieval system